LXL04_025722 | RubberDandelionOmics

Gene overview

LXL04_025722

Reference: OH-1004 Chr: Chr05 Coordinates: 115857734-115859813 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_025722|LXL04_025722|OH1004|cDNA

ATGTCGGGATCATCTGCTGTTGAAATCGATTTCTTTCGCATCAATGCCGAATCATATGCCCCGAAGAAGCTTTCTGATCGCCGAGATATACAAGGCGTGGTATCGAAGATTAATCCGGAGCTTCTGAAAACTGCGATAGCTACTGCATCTGCCAACATGAGTTTCGTCTCGAGCAAGTCATGTTCGTCTCCTGATCATCAGCTATTTGATTCTCTGCCGGTTTTTAATCAGGACAGTGGCGGTGTAAATATGGCGCGATA...

CDS

Download CDS FASTA

555 bp · LXL04_025722|LXL04_025722|OH1004|CDS

ATGTCGGGATCATCTGCTGTTGAAATCGATTTCTTTCGCATCAATGCCGAATCATATGCCCCGAAGAAGCTTTCTGATCGCCGAGATATACAAGGCGTGGTATCGAAGATTAATCCGGAGCTTCTGAAAACTGCGATAGCTACTGCATCTGCCAACATGAGTTTCGTCTCGAGCAAGTCATGTTCGTCTCCTGATCATCAGCTATTTGATTCTCTGCCGGTTTTTAATCAGGACAGTGGCGGTGTAAATATGGCGCGATA...

Protein

Download Protein FASTA

184 aa · LXL04_025722|LXL04_025722|OH1004|PROTEIN

MSGSSAVEIDFFRINAESYAPKKLSDRRDIQGVVSKINPELLKTAIATASANMSFVSSKSCSSPDHQLFDSLPVFNQDSGGVNMARYGAPMTIFYNGTVSVFDVTPTQVENIVKLAESGSSGSKAVVEPAVVKPPGSSQSPAVGGALKEDLPMSRKKSLRRFLEKRKERQVSVSPYSKGNASLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025722`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025722

Location Chr05:115857734-115859813 (-)

Description Similar to TIFY9: Protein TIFY 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13220`	Repressor of jasmonate (JA) responses that lacks the entire Jas domain and possesses severe JA insensitivity and resistance to JA-induced degradation.	A downstream mediator in the growth repression limb of the jasmonate pathway.2007 · DOI: 10.1105/tpc.107.050708 A critical role for the TIFY motif in repression of jasmonate signaling by a stabilized splice variant of the JASMONATE ZIM-domain protein JAZ10 in Arabidopsis.2009 · DOI: 10.1105/tpc.108.064097 Negative feedback control of jasmonate signaling by an alternative splice variant of JAZ10.2013 · DOI: 10.1104/pp.113.218164
`At1g74950`	Repressor of jasmonate responses.	No verified direct reference in this release
`At3g43440`	Repressor of jasmonate (JA) responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0395800`	Repressor of jasmonate responses.	No verified direct reference in this release
`UniProt: A2XSX6`	Repressor of jasmonate responses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025722 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010112 regulation of systemic acquired resistance Biological Process

GO:0031347 regulation of defense response Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G74950

ath:AT3G43440

ath:AT5G13220

dosa:Os04g0395800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.823

Rank 1 · LXL04_025722 · OH-1004

Cytoplasm0.216

Rank 2 · LXL04_025722 · OH-1004

Cell membrane0.090

Rank 3 · LXL04_025722 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_025722 · OH-1004

Plastid0.022

Rank 5 · LXL04_025722 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06200.20tify89-116 aa

PF09425.16Jas_motif152-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025722	`PF06200.20`	tify	89	116	2.4e-10	40.3
LXL04_025722	`PF09425.16`	Jas_motif	152	177	1e-10	41.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZM9`	Arabidopsis thaliana	Protein TIFY 9	38.579%	Swiss-Prot	moderate database homology
`Q9S7M2`	Arabidopsis thaliana	Protein TIFY 10B	35.135%	Swiss-Prot	weak database homology
`Q9M246`	Arabidopsis thaliana	Protein TIFY 3A	32.967%	Swiss-Prot	weak database homology
`Q7XV97`	Oryza sativa subsp. japonica	Protein TIFY 9	39.560%	Swiss-Prot	weak database homology
`A2XSX6`	Oryza sativa subsp. indica	Protein TIFY 9	39.560%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card