Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1308 bp · LXL04_025713|LXL04_025713|OH1004|cDNA
ATGGCTTCTATCTCCAAGCTTTCTACTCCGGTCGCCCATTTAAACTCCTCCCCTTTGCTTCCCAAAACGCCCTCCACCTCCGTCTCTCTTCGGGTTCCTTCGAAGCTTGCGCTTTCGTCCTCCAGGTTGTCCCTTCGCACCAACGCCCCTCTAGCCGCCTCTTTGCTTGTAAAATGTAGCCAAGTTGGCGGAAACGGAACCCCAATCAAGAGAACAACTCTTCACGATCTTTACCACAAGCAAGGCCAAAGTCCATGGTA...
1308 bp · LXL04_025713|LXL04_025713|OH1004|CDS
ATGGCTTCTATCTCCAAGCTTTCTACTCCGGTCGCCCATTTAAACTCCTCCCCTTTGCTTCCCAAAACGCCCTCCACCTCCGTCTCTCTTCGGGTTCCTTCGAAGCTTGCGCTTTCGTCCTCCAGGTTGTCCCTTCGCACCAACGCCCCTCTAGCCGCCTCTTTGCTTGTAAAATGTAGCCAAGTTGGCGGAAACGGAACCCCAATCAAGAGAACAACTCTTCACGATCTTTACCACAAGCAAGGCCAAAGTCCATGGTA...
Protein
Download Protein FASTA435 aa · LXL04_025713|LXL04_025713|OH1004|PROTEIN
MASISKLSTPVAHLNSSPLLPKTPSTSVSLRVPSKLALSSSRLSLRTNAPLAASLLVKCSQVGGNGTPIKRTTLHDLYHKQGQSPWYDNLCRPVTDLLPLIESGVRGVTSNPAIFQKAISTSNAYNDQFKQLVQGGKDIESAYWELVVKDIQDACRLFESIYDETDGGDGYVSVEVSPQLADDTKGTVDAAKWLHKVVDRPNVYIKIPATAACVPSIKDVIALGISVNVTLIFSLSRYEAVMDAYLDGLEASGLDDLSRV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025713 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025713 |
|---|---|
| Location | Chr05:115682379-115684537 (-) |
| Description | Similar to tal2: Transaldolase 2 (Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0006098 pentose-phosphate shunt Biological Process GO:0005737 cytoplasm Cellular Component GO:0004801 transaldolase activity Molecular Function |
| KEGG gene cross-reference | ace:Acel_1126 msb:LJ00_15430 msg:MSMEI_3024 msm:MSMEG_3102 rsa:RSal33209_2247 sco:SCO1936 sma:SAVERM_6314 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00923.26TAL_FSA99-422 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025713 | PF00923.26 | TAL_FSA | 99 | 422 | 1.8e-74 | 251.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.