Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2259 bp · LXL04_025695|LXL04_025695|OH1004|cDNA
AATTGCTCATCCATCTGCCACCTAGTATCTAATCGAATCGAAGTACCGTCGCCGGATCTCGCCGGTCACGTTTGTCTGTTTCCACCTCCTCCTGCTGACCAAGCCTTCTTGACTCTCTCTCCCATACGCTTCTTATATTTCCCTCCCCCGATATCCCCGCCGCTCTCAAACAACTCTTTCACCCCTTCTCCGCCCCCATTTCGTTCTCTCATCAAGAAATCATTTGCCATGGGTTTACCTGATGGAGAAGTGCACATAGC...
2184 bp · LXL04_025695|LXL04_025695|OH1004|CDS
CTGTTTCCACCTCCTCCTGCTGACCAAGCCTTCTTGACTCTCTCTCCCATACGCTTCTTATATTTCCCTCCCCCGATATCCCCGCCGCTCTCAAACAACTCTTTCACCCCTTCTCCGCCCCCATTTCGTTCTCTCATCAAGAAATCATTTGCCATGGGTTTACCTGATGGAGAAGTGCACATAGCAACCGCTGTTGATATCCAATCGCCGGAGTTTTATGACAGTAAGATAAACAACAAGGTATTAAGCGACGATGATTG...
Protein
Download Protein FASTA727 aa · LXL04_025695|LXL04_025695|OH1004|PROTEIN
MFPPPPADQAFLTLSPIRFLYFPPPISPPLSNNSFTPSPPPFRSLIKKSFAMGLPDGEVHIATAVDIQSPEFYDSKINNKVLSDDDCGEQKTEQVDSDDSSVNDSSNSDGGSDEIEKREIHVQNEDKSDDEAKGLRKNRDDGEVFHPNPQLPKPEAPLGVVAIKTEGAQKPESSPLIKRSNSSPESAAAAVQIPAIGKFFREKSNSLSAAITKRLSLLADDIDDASEKKKISNITEFHLSGLKVTVKLKNEKEEKEEFKG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025695 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025695 |
|---|---|
| Location | Chr05:115473396-115477136 (+) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0006469 negative regulation of protein kinase activity Biological Process GO:0007186 G protein-coupled receptor signaling pathway Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0031669 cellular response to nutrient levels Biological Process GO:0032007 negative regulation of TOR signaling Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0038202 TORC1 signaling Biological Process GO:0045792 negative regulation of cell size Biological Process GO:1903940 negative regulation of TORC2 signaling Biological Process GO:1904262 negative regulation of TORC1 signaling Biological Process |
| KEGG gene cross-reference | hsa:64798 mmu:97998 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00462.31Glutaredoxin262-320 aaPF00610.28DEP382-449 aaPF04784.20DUF547529-655 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025695 | PF00462.31 | Glutaredoxin | 262 | 320 | 1.3e-12 | 48.4 |
| LXL04_025695 | PF00610.28 | DEP | 382 | 449 | 4e-19 | 69.0 |
| LXL04_025695 | PF04784.20 | DUF547 | 529 | 655 | 1.1e-33 | 116.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.