LXL04_025623 | RubberDandelionOmics

Gene overview

LXL04_025623

Reference: OH-1004 Chr: Chr05 Coordinates: 114447396-114449464 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · LXL04_025623|LXL04_025623|OH1004|cDNA

ATGGGTTGTTTCTTCGCATGTTTTCGTGTCAGAGACGACCGTCGGCCTCCGATCCACCTCCTCTCCCAACCAATCGCTTCAAATCCCAAGGATCGTGTCGACTCTGGAGCTAGAAATCATTTATCGTCTTTGCTACTTTTCGAAGCTGAAGATAGAGATCAATCGCCATGTAAGAACAGGAAATGCGATATTCCAGGATCTGCTTCCCCTGAGTTTAATTCAAAGGAGCTGAAAGCTGAGGCCAAATTTCTCAAAGCTTG...

CDS

Download CDS FASTA

1302 bp · LXL04_025623|LXL04_025623|OH1004|CDS

ATGGGTTGTTTCTTCGCATGTTTTCGTGTCAGAGACGACCGTCGGCCTCCGATCCACCTCCTCTCCCAACCAATCGCTTCAAATCCCAAGGATCGTGTCGACTCTGGAGCTAGAAATCATTTATCGTCTTTGCTACTTTTCGAAGCTGAAGATAGAGATCAATCGCCATGTAAGAACAGGAAATGCGATATTCCAGGATCTGCTTCCCCTGAGTTTAATTCAAAGGAGCTGAAAGCTGAGGCCAAATTTCTCAAAGCTTG...

Protein

Download Protein FASTA

433 aa · LXL04_025623|LXL04_025623|OH1004|PROTEIN

MGCFFACFRVRDDRRPPIHLLSQPIASNPKDRVDSGARNHLSSLLLFEAEDRDQSPCKNRKCDIPGSASPEFNSKELKAEAKFLKACGTLPQTPVEIRNNEKLKKSSPQKEDSEPTTYHSWLQSTSTETLKLEKQSNQQPSPVKLSEEWDNNSNSSSHSPDSCVAGHANQAQSHTPTPLNKFSEIDASSFSFSSSSSEVTSQYNVSKRSPYPTPLSLPNDMQTPGTVFHPSHHNKEIRKNPRIRSQYMIPTLSPVQNANQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025623`
TK1151 ID	TkA06G048260
OH-1004 ID	LXL04_025623
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025623

Location Chr05:114447396-114449464 (+)

Description Similar to JASON: Protein JASON

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06660`	Required for normal spindle orientation at male meiosis II and normal formation of tetrad of microspores.	The Arabidopsis mutant jason produces unreduced first division restitution male gametes through a parallel/fused spindle mechanism in meiosis II.2011 · DOI: 10.1104/pp.110.170415

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025623 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007142 male meiosis II Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0051295 establishment of meiotic spindle localization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

KEGG gene cross-reference

ath:AT1G06660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.442

Rank 1 · LXL04_025623 · OH-1004

Cytoplasm0.394

Rank 2 · LXL04_025623 · OH-1004

Nucleus0.363

Rank 3 · LXL04_025623 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_025623 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_025623 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDQ5`	Arabidopsis thaliana	Protein JASON	34.554%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card