LXL04_025509 | RubberDandelionOmics

Gene overview

LXL04_025509

Reference: OH-1004 Chr: Chr05 Coordinates: 112695870-112699120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1711 bp · LXL04_025509|LXL04_025509|OH1004|cDNA

ATGGAAATCTCGGAAACTTCTCGGAAACGTAAAGCTAGTGATCTTGATGAGAAGTCTCCTGTGGTTCTTTCAGAGTCTCCTTTGGTTTTTTCAGAGTCTCTTGCTGAGTTCTTTGCGGGGAATAAGAACAATGCTGGATTTGAAAACCCTAGGAAAGCGCTTTACACTACGGTGAGAGAACTTGTTGAAAATGGACTTGATTCTGCTGAGTCAATTGGGGAGTTTCCAGTGATTGAAGTAACAATTGAGGAGATTTCTAG...

CDS

Download CDS FASTA

1668 bp · LXL04_025509|LXL04_025509|OH1004|CDS

ATGGAAATCTCGGAAACTTCTCGGAAACGTAAAGCTAGTGATCTTGATGAGAAGTCTCCTGTGGTTCTTTCAGAGTCTCCTTTGGTTTTTTCAGAGTCTCTTGCTGAGTTCTTTGCGGGGAATAAGAACAATGCTGGATTTGAAAACCCTAGGAAAGCGCTTTACACTACGGTGAGAGAACTTGTTGAAAATGGACTTGATTCTGCTGAGTCAATTGGGGAGTTTCCAGTGATTGAAGTAACAATTGAGGAGATTTCTAG...

Protein

Download Protein FASTA

555 aa · LXL04_025509|LXL04_025509|OH1004|PROTEIN

MEISETSRKRKASDLDEKSPVVLSESPLVFSESLAEFFAGNKNNAGFENPRKALYTTVRELVENGLDSAESIGEFPVIEVTIEEISRSCYNSTIDDDSEKLLDKNSALGIKVEERTAAKPMKGGSFYRVTCTDNGRGIPHDAIPDIFGRVSIRKKYGMKQTRGKSGLGGVKMVSVWSNMSTGVPVEIYTGMKDQKYRTSCSLDIDIHRNMPIVHSLNLTKSEDGDDWHGAKITVVIKGNYGSGILEYMRLMAVITPYAEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025509`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025509

Location Chr05:112695870-112699120 (-)

Description Similar to TOP6B: DNA topoisomerase 6 subunit B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20780`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	A crucial role for the putative Arabidopsis topoisomerase VI in plant growth and development.2002 · DOI: 10.1073/pnas.152337599 DNA topoisomerase VI is essential for endoreduplication in Arabidopsis.2002 · DOI: 10.1016/s0960-9822(02)01198-3

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BDQ4`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	No verified direct reference in this release
`Os09g0279600`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025509 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006260 DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009330 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex Cellular Component

GO:0015935 small ribosomal subunit Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G20780

dosa:Os09g0279600

osa:4346606

sin:YN1551_1608

sshi:J5U23_02508

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.500

Rank 1 · LXL04_025509 · OH-1004

Cytoplasm0.466

Rank 2 · LXL04_025509 · OH-1004

Mitochondrion0.073

Rank 3 · LXL04_025509 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_025509 · OH-1004

Endoplasmic reticulum0.039

Rank 5 · LXL04_025509 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518.32HATPase_c53-173 aa

PF09239.18Topo-VIb_trans372-522 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025509	`PF02518.32`	HATPase_c	53	173	4.1e-06	27.9
LXL04_025509	`PF09239.18`	Topo-VIb_trans	372	522	7.3e-43	146.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5V6`	Arabidopsis thaliana	DNA topoisomerase 6 subunit B	53.610%	Swiss-Prot	strong database homology
`B8BDQ4`	Oryza sativa subsp. indica	DNA topoisomerase 6 subunit B	53.947%	Swiss-Prot	strong database homology
`Q6H442`	Oryza sativa subsp. japonica	DNA topoisomerase 6 subunit B	53.947%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card