LXL04_025499 | RubberDandelionOmics

Gene overview

LXL04_025499

Reference: OH-1004 Chr: Chr05 Coordinates: 112541944-112543074 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_025499|LXL04_025499|OH1004|cDNA

ATGTTAGATTACTTCCCTCGCGACCTACTAATCGAGATCCTCAAATGGCTCCCTGTCAATTCCATTCTCCAATGTCGTACAGTCTGCAAATCGTGGAATTCCCTCGTTACCAGCAACGATTTCATCTCCGCTCACCACAATTTAACCAAATCGATAATCGAAAACGGAAATCAGACGCTACTGATCAGGTACTTCGATCAAACACGTAAACTCGAGCAATACATCATAGGAAAAGATGATGAAACCTTCGGGTTAAAGTT...

CDS

Download CDS FASTA

1131 bp · LXL04_025499|LXL04_025499|OH1004|CDS

ATGTTAGATTACTTCCCTCGCGACCTACTAATCGAGATCCTCAAATGGCTCCCTGTCAATTCCATTCTCCAATGTCGTACAGTCTGCAAATCGTGGAATTCCCTCGTTACCAGCAACGATTTCATCTCCGCTCACCACAATTTAACCAAATCGATAATCGAAAACGGAAATCAGACGCTACTGATCAGGTACTTCGATCAAACACGTAAACTCGAGCAATACATCATAGGAAAAGATGATGAAACCTTCGGGTTAAAGTT...

Protein

Download Protein FASTA

376 aa · LXL04_025499|LXL04_025499|OH1004|PROTEIN

MLDYFPRDLLIEILKWLPVNSILQCRTVCKSWNSLVTSNDFISAHHNLTKSIIENGNQTLLIRYFDQTRKLEQYIIGKDDETFGLKFSNIEFQHASTSAYFRVVGYYDGVVCLSDDLFDSMFMVILWNPSIKKSIRVMVPNYEQNWIQRAVLGFGVCQRTHDPKIVRIAYQNNSSMPHKLHDSPLIDVFSLASGGWRQPLGGRFNRPHKLIRITWSQVCFNGVIHWVACEQQLDPNLRCLIISFDLVHEVFDEMPLPDVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025499`
TK1151 ID	TkA06G056300
OH-1004 ID	LXL04_025499
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 35.904 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025499

Location Chr05:112541944-112543074 (+)

Description Similar to At3g07870: F-box protein At3g07870

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07870`	F-box protein At3g07870.	No verified direct reference in this release
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At3g16590`	Putative F-box protein At3g16590.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At2g27520`	F-box/LRR-repeat/kelch-repeat protein At2g27520.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025499 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G27520

ath:AT3G06240

ath:AT3G07870

ath:AT3G16590

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.700

Rank 1 · LXL04_025499 · OH-1004

Nucleus0.371

Rank 2 · LXL04_025499 · OH-1004

Cell membrane0.095

Rank 3 · LXL04_025499 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_025499 · OH-1004

Lysosome / Vacuole0.044

Rank 5 · LXL04_025499 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box5-41 aa

PF12937.13F-box-like6-39 aa

PF08268.18FBA_386-335 aa

PF07734.19FBA_1101-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025499	`PF00646.39`	F-box	5	41	3.2e-11	43.4
LXL04_025499	`PF12937.13`	F-box-like	6	39	1.7e-08	34.8
LXL04_025499	`PF08268.18`	FBA_3	86	335	1e-11	45.2
LXL04_025499	`PF07734.19`	FBA_1	101	321	3.8e-24	86.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFC7`	Arabidopsis thaliana	F-box protein At3g07870	27.164%	Swiss-Prot	weak database homology
`Q8GXC7`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g06240	25.532%	Swiss-Prot	weak database homology
`Q9LUS5`	Arabidopsis thaliana	Putative F-box protein At3g16590	24.650%	Swiss-Prot	weak database homology
`Q9LIR8`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g23880	25.153%	Swiss-Prot	weak database homology
`Q9ZNQ3`	Arabidopsis thaliana	F-box/LRR-repeat/kelch-repeat protein At2g27520	23.197%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card