LXL04_025479 | RubberDandelionOmics

Gene overview

LXL04_025479

Reference: OH-1004 Chr: Chr05 Coordinates: 112325785-112326803 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · LXL04_025479|LXL04_025479|OH1004|cDNA

ATGGCATCTCCCACCTTAATCACTCCCACTACCACCACCCCTAAGCGCCTCCTTTCCATTCGCTCCAAGCACTCCACACCCAGCTccccctccaccaccaccaccgccactaCCCATCGCCGAAACTTCTTGTCACTAGCTGCCGTAATTTCCATCTCCTCCCCCCTACTTGTTATTCCGGCTGCATTGGCGGCTTCCGATGAAGAATACGCAAAAGAGACCCAGGAGGTTATCCAGAAGGTCAGAAACACGATCAACAT...

CDS

Download CDS FASTA

546 bp · LXL04_025479|LXL04_025479|OH1004|CDS

ATGGCATCTCCCACCTTAATCACTCCCACTACCACCACCCCTAAGCGCCTCCTTTCCATTCGCTCCAAGCACTCCACACCCAGCTCCCCCTCCACCACCACCACCGCCACTACCCATCGCCGAAACTTCTTGTCACTAGCTGCCGTAATTTCCATCTCCTCCCCCCTACTTGTTATTCCGGCTGCATTGGCGGCTTCCGATGAAGAATACGCAAAAGAGACCCAGGAGGTTATCCAGAAGGTCAGAAACACGATCAACAT...

Protein

Download Protein FASTA

181 aa · LXL04_025479|LXL04_025479|OH1004|PROTEIN

MASPTLITPTTTTPKRLLSIRSKHSTPSSPSTTTTATTHRRNFLSLAAVISISSPLLVIPAALAASDEEYAKETQEVIQKVRNTINMDKTDPNIAAAVAELRETSNSWVAKYRREKALLGRISFRDMYSALNAVSGHYVSFGPTSPIPAKRKTRILEEMDSVEKALSRGRYMRLVANEPGP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025479`
TK1151 ID	TkA06G057110
OH-1004 ID	LXL04_025479
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 93.923 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025479

Location Chr05:112325785-112326803 (-)

Description Similar to PSB27-1: Photosystem II repair protein PSB27-H1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03600`	Probably involved in repair of photodamaged photosystem II (PSII).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025479 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010206 photosystem II repair Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

KEGG gene cross-reference

ath:AT1G03600

syn:slr1645

tel:tll2464

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_025479 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_025479 · OH-1004

Nucleus0.014

Rank 3 · LXL04_025479 · OH-1004

Cytoplasm0.009

Rank 4 · LXL04_025479 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_025479 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13326.12PSII_Pbs2740-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025479	`PF13326.12`	PSII_Pbs27	40	166	4.3e-34	118.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LR64`	Arabidopsis thaliana	Photosystem II repair protein PSB27-H1, chloroplastic	70.896%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card