LXL04_025404 | RubberDandelionOmics

Gene overview

LXL04_025404

Reference: OH-1004 Chr: Chr05 Coordinates: 111123570-111126462 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1809 bp · LXL04_025404|LXL04_025404|OH1004|cDNA

ATGTCCAGATATTTCAATTTCCCCACCACGTCAATGTCTACCAATTCATCTTCTCCTCACTTCTTCAATTCCTCCACAGCAAACCAGATCAACAATACTCCATTCATGGATCCTAAAACCCTAATTCGCCACAACGCATACCTCAAAACAATCCCAGTAAGCCCTAAATTCAATTCATTACCCTCCTATTTGTCTCCTTCGCAATGCCGTTCGCGCATTCAATCTAGCCTTCGATCGTCCCATTATCCGTTGTTTGGAAA...

CDS

Download CDS FASTA

1809 bp · LXL04_025404|LXL04_025404|OH1004|CDS

ATGTCCAGATATTTCAATTTCCCCACCACGTCAATGTCTACCAATTCATCTTCTCCTCACTTCTTCAATTCCTCCACAGCAAACCAGATCAACAATACTCCATTCATGGATCCTAAAACCCTAATTCGCCACAACGCATACCTCAAAACAATCCCAGTAAGCCCTAAATTCAATTCATTACCCTCCTATTTGTCTCCTTCGCAATGCCGTTCGCGCATTCAATCTAGCCTTCGATCGTCCCATTATCCGTTGTTTGGAAA...

Protein

Download Protein FASTA

602 aa · LXL04_025404|LXL04_025404|OH1004|PROTEIN

MSRYFNFPTTSMSTNSSSPHFFNSSTANQINNTPFMDPKTLIRHNAYLKTIPVSPKFNSLPSYLSPSQCRSRIQSSLRSSHYPLFGKIRYRNQLFTHINPSRRVSEEGNVSGYRSGPSFAAVSSFGDSAEEEEDIVSKKTGIEENLAVNDSIWDQLVEIVKFSGPAAGLWLCGPLMSLIDTAVIGQSSSVELAALGTAIWPGTVLCDYMSYGFMFLSVATSNMVATSLAKQDKSEVQHQLSTLLFVGLACGLLMLFFTRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025404`
TK1151 ID	TkA06G061570
OH-1004 ID	LXL04_025404
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025404

Location Chr05:111123570-111126462 (-)

Description Similar to DTX46: Protein DETOXIFICATION 46, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21340`	Protein DETOXIFICATION 46, chloroplastic.	No verified direct reference in this release
`At4g39030`	Functions as a multidrug and toxin extrusion transporter in the export of salicylic acid (SA) from the chloroplast to the cytoplasm.	EDS5, an essential component of salicylic acid-dependent signaling for disease resistance in Arabidopsis, is a member of the MATE transporter family.2002 · DOI: 10.1105/tpc.010376 Age-related resistance in Arabidopsis is a developmentally regulated defense response to Pseudomonas syringae.2002 · DOI: 10.1105/tpc.010481 Forward and reverse genetics to identify genes involved in the age-related resistance response in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1364-3703.2009.00557.x Export of salicylic acid from the chloroplast requires the multidrug and toxin extrusion-like transporter EDS5.2013 · DOI: 10.1104/pp.113.218156 Investigation of intercellular salicylic acid accumulation during compatible and incompatible Arabidopsis-pseudomonas syringae interactions using a fast neutron-generated mutant allele of EDS5 identified by genetic mapping and whole-genome sequencing.2014 · DOI: 10.1371/journal.pone.0088608
`At2g38330`	Protein DETOXIFICATION 44, chloroplastic.	No verified direct reference in this release
`At3g08040`	Citrate transporter responsible for loading citrate into xylem tissues, which helps facilitate iron transport to shoots.	FRD3, a member of the multidrug and toxin efflux family, controls iron deficiency responses in Arabidopsis.2002 · DOI: 10.1105/tpc.001495 FRD3 controls iron localization in Arabidopsis.2004 · DOI: 10.1104/pp.104.045633 The FRD3-mediated efflux of citrate into the root vasculature is necessary for efficient iron translocation.2007 · DOI: 10.1104/pp.107.097162 The FRD3 citrate effluxer promotes iron nutrition between symplastically disconnected tissues throughout Arabidopsis development.2011 · DOI: 10.1105/tpc.111.088088
`At4g38380`	Protein DETOXIFICATION 45, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006952 defense response Biological Process

GO:0009624 response to nematode Biological Process

GO:0009697 salicylic acid biosynthetic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030001 metal ion transport Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT2G21340

ath:AT2G38330

ath:AT3G08040

ath:AT4G38380

ath:AT4G39030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · LXL04_025404 · OH-1004

Peroxisome0.021

Rank 2 · LXL04_025404 · OH-1004

Cytoplasm0.019

Rank 3 · LXL04_025404 · OH-1004

Golgi apparatus0.019

Rank 4 · LXL04_025404 · OH-1004

Mitochondrion0.019

Rank 5 · LXL04_025404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE171-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025404	`PF01554.24`	MatE	171	326	2.7e-14	53.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4G3`	Arabidopsis thaliana	Protein DETOXIFICATION 46, chloroplastic	70.861%	Swiss-Prot	strong database homology
`Q945F0`	Arabidopsis thaliana	Protein DETOXIFICATION 47, chloroplastic	65.275%	Swiss-Prot	strong database homology
`Q84K71`	Arabidopsis thaliana	Protein DETOXIFICATION 44, chloroplastic	23.701%	Swiss-Prot	weak database homology
`Q9SFB0`	Arabidopsis thaliana	Protein DETOXIFICATION 43	25.208%	Swiss-Prot	weak database homology
`Q9SVE7`	Arabidopsis thaliana	Protein DETOXIFICATION 45, chloroplastic	23.697%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card