LXL04_025396 | RubberDandelionOmics

Gene overview

LXL04_025396

Reference: OH-1004 Chr: Chr05 Coordinates: 111040453-111042995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_025396|LXL04_025396|OH1004|cDNA

ATGCATAACATACTTCTCTTTGTACTCTTAACATACTCACTCTCAATTGTTCCAGTAACACATGGATGTTTTATTATGAAAAAATGGGATGTTTTTGTTAAGAATGATATCCCTGATGGTATCATTGTCACTCACATTAAATCaaaagatgatgatcttggAAGTCATACTATTTCATATGGAGAAAGTTATCGCTGGTCTTTTTGTGACAGGGTTTATGGTACAACTCTTTTCTCTGGTTACTTCTCGTGGAGTTCGCA...

CDS

Download CDS FASTA

432 bp · LXL04_025396|LXL04_025396|OH1004|CDS

ATGCATAACATACTTCTCTTTGTACTCTTAACATACTCACTCTCAATTGTTCCAGTAACACATGGATGTTTTATTATGAAAAAATGGGATGTTTTTGTTAAGAATGATATCCCTGATGGTATCATTGTCACTCACATTAAATCAAAAGATGATGATCTTGGAAGTCATACTATTTCATATGGAGAAAGTTATCGCTGGTCTTTTTGTGACAGGGTTTATGGTACAACTCTTTTCTCTGGTTACTTCTCGTGGAGTTCGCA...

Protein

Download Protein FASTA

143 aa · LXL04_025396|LXL04_025396|OH1004|PROTEIN

MHNILLFVLLTYSLSIVPVTHGCFIMKKWDVFVKNDIPDGIIVTHIKSKDDDLGSHTISYGESYRWSFCDRVYGTTLFSGYFSWSSHFQNLALYDKEIRRRCFVAKGGTEHCYWSLISVIDPFFSPSTTRYSIWRIMTKLPSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025396`
TK1151 ID	TkA06G061800
OH-1004 ID	LXL04_025396
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 80.531 / OH-1004 63.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025396

Location Chr05:111040453-111042995 (-)

Description Similar to SPH2: S-protein homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16195`	S-protein homolog 2.	No verified direct reference in this release
`At1g04645`	S-protein homolog 5.	No verified direct reference in this release
`At5g37035`	S-protein homolog 29.	No verified direct reference in this release
`At5g12060`	S-protein homolog 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025396 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0060320 rejection of self pollen Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G04645

ath:AT4G16195

ath:AT5G12060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.380

Rank 1 · LXL04_025396 · OH-1004

Lysosome / Vacuole0.315

Rank 2 · LXL04_025396 · OH-1004

Endoplasmic reticulum0.163

Rank 3 · LXL04_025396 · OH-1004

Cytoplasm0.152

Rank 4 · LXL04_025396 · OH-1004

Cell membrane0.108

Rank 5 · LXL04_025396 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05938.18Self-incomp_S131-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025396	`PF05938.18`	Self-incomp_S1	31	115	7.9e-13	49.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JLQ5`	Arabidopsis thaliana	S-protein homolog 2	30.435%	Swiss-Prot	moderate database homology
`O23020`	Arabidopsis thaliana	S-protein homolog 5	30.233%	Swiss-Prot	moderate database homology
`P0DN93`	Arabidopsis thaliana	S-protein homolog 29	30.702%	Swiss-Prot	moderate database homology
`Q9FMQ4`	Arabidopsis thaliana	S-protein homolog 3	27.407%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card