LXL04_025345 | RubberDandelionOmics

Gene overview

LXL04_025345

Reference: OH-1004 Chr: Chr05 Coordinates: 110152878-110157448 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3486 bp · LXL04_025345|LXL04_025345|OH1004|cDNA

ATGGCCGCTGAAGCATCATCATCTTCAACTGTCCAAACAAGAGAAAATGAGAAGAAAGAAAAAATGAGCTGGAGCAAATTGTATACGTTCTCATGCATACGGCCCCAGTCAAACAAATCAGATTTGGGACAACCCGGTTTCTCCAGGGTTGTGTTCTGCAATAATCCAAACAGGCCGGCATATACGTACCCCAGCAATTATGTCGCTACAACAAAGTACAATTTGGCGACATTTTTGCCAAAATGTCTCTTCGAGCAGTT...

CDS

Download CDS FASTA

3486 bp · LXL04_025345|LXL04_025345|OH1004|CDS

ATGGCCGCTGAAGCATCATCATCTTCAACTGTCCAAACAAGAGAAAATGAGAAGAAAGAAAAAATGAGCTGGAGCAAATTGTATACGTTCTCATGCATACGGCCCCAGTCAAACAAATCAGATTTGGGACAACCCGGTTTCTCCAGGGTTGTGTTCTGCAATAATCCAAACAGGCCGGCATATACGTACCCCAGCAATTATGTCGCTACAACAAAGTACAATTTGGCGACATTTTTGCCAAAATGTCTCTTCGAGCAGTT...

Protein

Download Protein FASTA

1161 aa · LXL04_025345|LXL04_025345|OH1004|PROTEIN

MAAEASSSSTVQTRENEKKEKMSWSKLYTFSCIRPQSNKSDLGQPGFSRVVFCNNPNRPAYTYPSNYVATTKYNLATFLPKCLFEQFRRVANMYFLLAAVLSLTSLTPFSPLSLIAPLLFVVGVSLMKEGVEDWRRRTTDREVNSRTVKVHTANGAPFTDRPWKALQVGDIIKVGKNEYFPADLLLLSSSYEDGLCYVETMNLDGETNLKIKRSLECTTGLDDEQKIEKFTATIRCEDPNPSLYTFVGNLDLGEEDGMIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025345`
TK1151 ID	TkA06G064630
OH-1004 ID	LXL04_025345
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025345

Location Chr05:110152878-110157448 (-)

Description Similar to ALA5: Probable phospholipid-transporting ATPase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72700`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g17500`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g54280`	Involved in transport of phospholipids and in regulation of pollen plasma membrane lipid asymmetry.	Loss of the Arabidopsis thaliana P4-ATPases ALA6 and ALA7 impairs pollen fitness and alters the pollen tube plasma membrane.2015 · DOI: 10.3389/fpls.2015.00197
`At3g13900`	Involved in transport of phospholipids and in regulation of pollen plasma membrane lipid asymmetry.	Loss of the Arabidopsis thaliana P4-ATPases ALA6 and ALA7 impairs pollen fitness and alters the pollen tube plasma membrane.2015 · DOI: 10.3389/fpls.2015.00197
`At1g68710`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025345 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0010286 heat acclimation Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:1905038 regulation of membrane lipid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G17500

ath:AT1G54280

ath:AT1G68710

ath:AT1G72700

ath:AT3G13900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.337

Rank 1 · LXL04_025345 · OH-1004

Endoplasmic reticulum0.291

Rank 2 · LXL04_025345 · OH-1004

Golgi apparatus0.251

Rank 3 · LXL04_025345 · OH-1004

Cytoplasm0.181

Rank 4 · LXL04_025345 · OH-1004

Lysosome / Vacuole0.172

Rank 5 · LXL04_025345 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209.11PhoLip_ATPase_N51-114 aa

PF13246.13Cation_ATPase503-697 aa

PF16212.12PhoLip_ATPase_C868-1118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025345	`PF16209.11`	PhoLip_ATPase_N	51	114	1.4e-21	76.7
LXL04_025345	`PF13246.13`	Cation_ATPase	503	697	1.3e-18	68.1
LXL04_025345	`PF16212.12`	PhoLip_ATPase_C	868	1118	1.7e-83	280.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGG3`	Arabidopsis thaliana	Probable phospholipid-transporting ATPase 5	54.327%	Swiss-Prot	strong database homology
`Q9LNQ4`	Arabidopsis thaliana	Probable phospholipid-transporting ATPase 4	53.879%	Swiss-Prot	strong database homology
`Q9SLK6`	Arabidopsis thaliana	Phospholipid-transporting ATPase 6	54.056%	Swiss-Prot	strong database homology
`Q9LVK9`	Arabidopsis thaliana	Probable phospholipid-transporting ATPase 7	53.077%	Swiss-Prot	strong database homology
`Q9SX33`	Arabidopsis thaliana	Putative phospholipid-transporting ATPase 9	51.127%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card