LXL04_025311 | RubberDandelionOmics

Gene overview

LXL04_025311

Reference: OH-1004 Chr: Chr05 Coordinates: 109528310-109531520 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1537 bp · LXL04_025311|LXL04_025311|OH1004|cDNA

GCCCTAATTCCCTGCTGATTGATCCAAGAGCTCGCGATTGCAATATATCTTCTTCCAGGAAAAAATGACTCAGGATGTTGAGATGAAAGAGCAGCAGGTCCCGGCAGCTGCAGCTCCTTCGAATTCCGTTTCATCTACCACTCCTGTTTTACAGCATTTAAAGGAAATTGCCGCACTGATCGAGACGGGAGCTTATGCTCGTGAAGTTCGTCGGATTTTGAGGGCTGTTAGGCTGACAATAGCATTAAGGAGGAAGTTAA...

CDS

Download CDS FASTA

1500 bp · LXL04_025311|LXL04_025311|OH1004|CDS

TTGCAATATATCTTCTTCCAGGAAAAAATGACTCAGGATGTTGAGATGAAAGAGCAGCAGGTCCCGGCAGCTGCAGCTCCTTCGAATTCCGTTTCATCTACCACTCCTGTTTTACAGCATTTAAAGGAAATTGCCGCACTGATCGAGACGGGAGCTTATGCTCGTGAAGTTCGTCGGATTTTGAGGGCTGTTAGGCTGACAATAGCATTAAGGAGGAAGTTAAAGGCTTCTATAGTTTCTTCGTTCCTCAACGTTGCTCT...

Protein

Download Protein FASTA

499 aa · LXL04_025311|LXL04_025311|OH1004|PROTEIN

MQYIFFQEKMTQDVEMKEQQVPAAAAPSNSVSSTTPVLQHLKEIAALIETGAYAREVRRILRAVRLTIALRRKLKASIVSSFLNVALAPGSEAHTRLSSYLPKDDQNDMEVDTASSATQTTVKHSPELEIYCYLLVLIFLIDQKKYSEAKSCSSASIARLKNLNRRTVDVLASRLYFYYSLSYELTGDLSEIRGNLLSLHRVATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRYLFYLGKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025311`
TK1151 ID	TkA06G068560
OH-1004 ID	LXL04_025311
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.196 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025311

Location Chr05:109528310-109531520 (-)

Description Similar to 21D7: Probable 26S proteasome non-ATPase regulatory subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20200`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release
`At1g75990`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025311 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0042176 regulation of protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005838 proteasome regulatory particle Cellular Component

GO:0008541 proteasome regulatory particle, lid subcomplex Cellular Component

KEGG gene cross-reference

ath:AT1G20200

ath:AT1G75990

dme:Dmel_CG42641

nta:107767363

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.634

Rank 1 · LXL04_025311 · OH-1004

Cytoplasm0.427

Rank 2 · LXL04_025311 · OH-1004

Lysosome / Vacuole0.051

Rank 3 · LXL04_025311 · OH-1004

Golgi apparatus0.051

Rank 4 · LXL04_025311 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_025311 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25573.1TPR_PSMD3_N35-328 aa

PF01399.34PCI347-428 aa

PF08375.17Rpn3_C432-498 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025311	`PF25573.1`	TPR_PSMD3_N	35	328	2e-107	360.0
LXL04_025311	`PF01399.34`	PCI	347	428	2.9e-19	69.8
LXL04_025311	`PF08375.17`	Rpn3_C	432	498	3.2e-27	95.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNU4`	Arabidopsis thaliana	26S proteasome non-ATPase regulatory subunit 3 homolog A	82.520%	Swiss-Prot	strong database homology
`Q9LQR8`	Arabidopsis thaliana	26S proteasome non-ATPase regulatory subunit 3 homolog B	81.466%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card