LXL04_025229 | RubberDandelionOmics

Gene overview

LXL04_025229

Reference: OH-1004 Chr: Chr05 Coordinates: 108222880-108224486 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · LXL04_025229|LXL04_025229|OH1004|cDNA

ATGGATCCGCCAATGATGATGAATGGAGGTGGTTTTCGGTCAAGTAATACGGGGTCGTCGTTGTGTAATTTGCCTGAGATCTGGCCCTTTCAGATAAATCTAGGCGGTGGCAGCGGCAATGCGGCGTCGTTTGGTATGGGGCAATTGGGGGATAATACCAGTGGAAGTGGTGTGTTTTTGGATAATCGAGATCATGTGGCGGTGGATGATCCGATGGTTGTGGACCAGAGAGGGAATAGTAATCAGAGTAAGAAACGACG...

CDS

Download CDS FASTA

849 bp · LXL04_025229|LXL04_025229|OH1004|CDS

ATGGATCCGCCAATGATGATGAATGGAGGTGGTTTTCGGTCAAGTAATACGGGGTCGTCGTTGTGTAATTTGCCTGAGATCTGGCCCTTTCAGATAAATCTAGGCGGTGGCAGCGGCAATGCGGCGTCGTTTGGTATGGGGCAATTGGGGGATAATACCAGTGGAAGTGGTGTGTTTTTGGATAATCGAGATCATGTGGCGGTGGATGATCCGATGGTTGTGGACCAGAGAGGGAATAGTAATCAGAGTAAGAAACGACG...

Protein

Download Protein FASTA

282 aa · LXL04_025229|LXL04_025229|OH1004|PROTEIN

MDPPMMMNGGGFRSSNTGSSLCNLPEIWPFQINLGGGSGNAASFGMGQLGDNTSGSGVFLDNRDHVAVDDPMVVDQRGNSNQSKKRREDDDSSKGVSTSSRSNGNSMLDSDGKRLKSLALETESESKPEPERSSGKKAENNAKPSDPPKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQQQVEFLSMKLEAVTSRSHPSPQGFTSKDYGQQTFEMTGVPFGSQPTRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025229`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025229

Location Chr05:108222880-108224486 (+)

Description Similar to BHLH094: Transcription factor BHLH094

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62610`	Transcription factor bHLH79.	No verified direct reference in this release
`At1g59640`	Involved in the control of petal size, by interfering with postmitotic cell expansion to limit final petal cell size.	No verified direct reference in this release
`At5g48560`	Transcription factor that binds DNA to G box 5'-CACGTG-3' and to E-box 5'-CANNTG-3' (By similarity).	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0193800`	Transcription factor that forms a ternary complex with RSS3 and TIFY11A/JAZ9 to negatively regulate jasmonate-responsive genes.	No verified direct reference in this release
`Os03g0802900`	Transcription factor that may regulate jasmonate-regulated genes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025229 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0048446 petal morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G59640

ath:AT5G48560

ath:AT5G62610

dosa:Os03g0802900

dosa:Os07g0193800

osa:4334471

osa:4342637

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.981

Rank 1 · LXL04_025229 · OH-1004

Cytoplasm0.081

Rank 2 · LXL04_025229 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_025229 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_025229 · OH-1004

Plastid0.010

Rank 5 · LXL04_025229 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH165-212 aa

PF23173.3bHLH_SAC51170-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025229	`PF00010.32`	HLH	165	212	2.6e-09	37.4
LXL04_025229	`PF23173.3`	bHLH_SAC51	170	214	8.3e-09	36.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV17`	Arabidopsis thaliana	Transcription factor bHLH79	46.048%	Swiss-Prot	moderate database homology
`Q0JXE7`	Arabidopsis thaliana	Transcription factor BPE	51.429%	Swiss-Prot	strong database homology
`Q9FJL4`	Arabidopsis thaliana	Transcription factor bHLH78	84.884%	Swiss-Prot	weak database homology
`Q69WS3`	Oryza sativa subsp. japonica	Transcription factor BHLH094	63.902%	Swiss-Prot	moderate database homology
`Q84T08`	Oryza sativa subsp. japonica	Transcription factor BHLH089	59.804%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card