LXL04_025158 | RubberDandelionOmics

Gene overview

LXL04_025158

Reference: OH-1004 Chr: Chr05 Coordinates: 106915073-106916460 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · LXL04_025158|LXL04_025158|OH1004|cDNA

ATGGGTGATCACTTGGTTGTAGATGTGAATCGACCCATTAAAATTAGCGCTGACGTGGCAGCCCCTTCATCTTCCACTACAGAAGCTCCTGTAGTAGATGAAGTCGGGGCTTCTTATGATGAAGAAGCGCCTCTTTTAACAATGGCAGAGTGTCGTATTTGCCAGGAGGAAGATTCCATTGATGCTTTAGAGACACCCTGCACTTGCAATGGCAGTCTTAAGTATGCTCACAGGAAGTGTGTACAACACTGGTGCAATGA...

CDS

Download CDS FASTA

819 bp · LXL04_025158|LXL04_025158|OH1004|CDS

ATGGGTGATCACTTGGTTGTAGATGTGAATCGACCCATTAAAATTAGCGCTGACGTGGCAGCCCCTTCATCTTCCACTACAGAAGCTCCTGTAGTAGATGAAGTCGGGGCTTCTTATGATGAAGAAGCGCCTCTTTTAACAATGGCAGAGTGTCGTATTTGCCAGGAGGAAGATTCCATTGATGCTTTAGAGACACCCTGCACTTGCAATGGCAGTCTTAAGTATGCTCACAGGAAGTGTGTACAACACTGGTGCAATGA...

Protein

Download Protein FASTA

272 aa · LXL04_025158|LXL04_025158|OH1004|PROTEIN

MGDHLVVDVNRPIKISADVAAPSSSTTEAPVVDEVGASYDEEAPLLTMAECRICQEEDSIDALETPCTCNGSLKYAHRKCVQHWCNEKGDIICEICHQPYQPGYIAPPPRPCMDETTIDIGEAWQISEADRQYLEAEYDDYNSTNASGAAFCRSAVLILMALLLLRHASSVPDSDTDGSDEDASTFLTLFLLRVAGFLLPCYIMVWAISILQRRRQRQEAAALAAAQFAFVLQAGQRRGIHLTVASVGPAPAQAPAPAPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025158`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_025158`
Location	Chr05:106915073-106916460 (+)
Description	Similar to SSM4: ERAD-associated E3 ubiquitin-protein ligase DOA10 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025158` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006897 endocytosis Biological Process GO:0016567 protein ubiquitination Biological Process GO:0030970 retrograde protein transport, ER to cytosol Biological Process GO:0036503 ERAD pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0000837 Doa10p ubiquitin ligase complex Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005637 nuclear inner membrane Cellular Component GO:0005764 lysosome Cellular Component GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	bta:520348 hsa:115123 mmu:320253 rno:364878 sce:YIL030C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.347

Rank 1 · LXL04_025158 · OH-1004

Cell membrane0.341

Rank 2 · LXL04_025158 · OH-1004

Endoplasmic reticulum0.198

Rank 3 · LXL04_025158 · OH-1004

Cytoplasm0.174

Rank 4 · LXL04_025158 · OH-1004

Golgi apparatus0.122

Rank 5 · LXL04_025158 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12906.14RINGv51-96 aa

PF12428.14DUF3675102-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025158	`PF12906.14`	RINGv	51	96	4e-13	50.0
LXL04_025158	`PF12428.14`	DUF3675	102	208	3.4e-31	109.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card