LXL04_025124 | RubberDandelionOmics

Gene overview

LXL04_025124

Reference: OH-1004 Chr: Chr05 Coordinates: 106458160-106459563 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1404 bp · LXL04_025124|LXL04_025124|OH1004|cDNA

ATGGCTGTCATCGCATTAAAATGCCCATCAATCGAAGTAGCAGTTGTCGACATCTCCGTGCCTCGAATCACAGCATGGAACAGCGAAAAACTCCCAATCTACGAGCCTGGACTCGACGACGTCGTTAAAAAATGCAGAGGGAGGAATCTCTTCTTCAGTAACGAAGTGGAAAAGAACGTCGCACAGGCGGACATAGTTTTCGTTTCCGTCAACACTCCAACAAAAAGCTCAGGCCTCGGCGCCGGAAAAGCCGCCGACCT...

CDS

Download CDS FASTA

1404 bp · LXL04_025124|LXL04_025124|OH1004|CDS

ATGGCTGTCATCGCATTAAAATGCCCATCAATCGAAGTAGCAGTTGTCGACATCTCCGTGCCTCGAATCACAGCATGGAACAGCGAAAAACTCCCAATCTACGAGCCTGGACTCGACGACGTCGTTAAAAAATGCAGAGGGAGGAATCTCTTCTTCAGTAACGAAGTGGAAAAGAACGTCGCACAGGCGGACATAGTTTTCGTTTCCGTCAACACTCCAACAAAAAGCTCAGGCCTCGGCGCCGGAAAAGCCGCCGACCT...

Protein

Download Protein FASTA

467 aa · LXL04_025124|LXL04_025124|OH1004|PROTEIN

MAVIALKCPSIEVAVVDISVPRITAWNSEKLPIYEPGLDDVVKKCRGRNLFFSNEVEKNVAQADIVFVSVNTPTKSSGLGAGKAADLTYWESAARMIADVSKSSKIVVEKSTVPVKTAEAIEKILTHNNKGIEFQILSNPEFLAEGTAIADLFDPDRVLIGGREETPAGLKAIKTLKDIYAHWVPQERIICTNLWSAELSKLAANAFLAQRISSVNSMSALCEATGADVTQVSYSVGKDSRIGPKFLSASVGFGGSCFQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025124`
TK1151 ID	TkA06G079980
OH-1004 ID	LXL04_025124
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 86.434 / OH-1004 47.752 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025124

Location Chr05:106458160-106459563 (+)

Description Similar to UGD1: UDP-glucose 6-dehydrogenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26570`	Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.	No verified direct reference in this release
`At5g39320`	Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0443500`	Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.	No verified direct reference in this release
`Os03g0757900`	Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025124 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006024 glycosaminoglycan biosynthetic process Biological Process

GO:0006065 UDP-glucuronate biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003979 UDP-glucose 6-dehydrogenase activity Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G26570

ath:AT5G39320

dosa:Os03g0757900

dosa:Os12g0443500

gmx:548074

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580

Rank 1 · LXL04_025124 · OH-1004

Nucleus0.255

Rank 2 · LXL04_025124 · OH-1004

Mitochondrion0.185

Rank 3 · LXL04_025124 · OH-1004

Peroxisome0.083

Rank 4 · LXL04_025124 · OH-1004

Plastid0.068

Rank 5 · LXL04_025124 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03721.22UDPG_MGDP_dh_N7-183 aa

PF00984.25UDPG_MGDP_dh195-289 aa

PF03720.23UDPG_MGDP_dh_C313-437 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025124	`PF03721.22`	UDPG_MGDP_dh_N	7	183	2.4e-54	184.7
LXL04_025124	`PF00984.25`	UDPG_MGDP_dh	195	289	4.1e-32	110.9
LXL04_025124	`PF03720.23`	UDPG_MGDP_dh_C	313	437	2.4e-32	112.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZE1`	Arabidopsis thaliana	UDP-glucose 6-dehydrogenase 1	80.942%	Swiss-Prot	strong database homology
`Q9FM01`	Arabidopsis thaliana	UDP-glucose 6-dehydrogenase 4	81.720%	Swiss-Prot	strong database homology
`Q2QS14`	Oryza sativa subsp. japonica	UDP-glucose 6-dehydrogenase 4	81.370%	Swiss-Prot	strong database homology
`Q9AUV6`	Oryza sativa subsp. japonica	UDP-glucose 6-dehydrogenase 3	81.156%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card