Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1107 bp · LXL04_025116|LXL04_025116|OH1004|cDNA
ATGGACCAACGAACGCAAGCGACGGCGCAACCACCGCCGCACCGCCGACCTCCGACGGAACCACTTGGCCAACAAGGAAATGGCGATTTCACGGTCATTCTCACCGTTCTATTTGCCTTCATTGCTATTTCCTCCCTTGTTATGTTTCCATCTTCATCTCCAAACTTGAAGAACAGCTTAACAATCTTACATCAAGTTCCTGAAGGTCATGTTGGCGTTTACTGGGTAGGTGGTGCCCTACAAAAGACAACCACAACTCC...
1107 bp · LXL04_025116|LXL04_025116|OH1004|CDS
ATGGACCAACGAACGCAAGCGACGGCGCAACCACCGCCGCACCGCCGACCTCCGACGGAACCACTTGGCCAACAAGGAAATGGCGATTTCACGGTCATTCTCACCGTTCTATTTGCCTTCATTGCTATTTCCTCCCTTGTTATGTTTCCATCTTCATCTCCAAACTTGAAGAACAGCTTAACAATCTTACATCAAGTTCCTGAAGGTCATGTTGGCGTTTACTGGGTAGGTGGTGCCCTACAAAAGACAACCACAACTCC...
Protein
Download Protein FASTA368 aa · LXL04_025116|LXL04_025116|OH1004|PROTEIN
MDQRTQATAQPPPHRRPPTEPLGQQGNGDFTVILTVLFAFIAISSLVMFPSSSPNLKNSLTILHQVPEGHVGVYWVGGALQKTTTTPGFHLKLPVITHYEPVQVTLQTDLVRDIPCGTKGGVMINFDRIEVVNRLKKESVYDTLVNYGVEYDHTWIYDKIHHEINQFCSVHSLQEVYIDMFDQIDETMKDALQADCTRYAPGIEILSVRVTKPRIPESVRRNFEQMEEERTKVLVSVERQRVAEKEAETQKKIAITEAEK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_025116 |
|---|---|
| TK1151 ID | TkA06G080360 |
| OH-1004 ID | LXL04_025116 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_025116 |
|---|---|
| Location | Chr05:106323981-106326927 (-) |
| Description | Similar to ERLIN2: Erlin-2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0008203 cholesterol metabolic process Biological Process GO:0032933 SREBP signaling pathway Biological Process GO:0036503 ERAD pathway Biological Process GO:0045540 regulation of cholesterol biosynthetic process Biological Process GO:0045541 negative regulation of cholesterol biosynthetic process Biological Process GO:0045717 negative regulation of fatty acid biosynthetic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0045121 membrane raft Cellular Component |
| KEGG gene cross-reference | bta:616278 hsa:11160 mmu:244373 pon:100173353 xla:444675 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01145.32Band_765-247 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_025116 | PF01145.32 | Band_7 | 65 | 247 | 2.7e-28 | 99.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.