LXL04_025079 | RubberDandelionOmics

Gene overview

LXL04_025079

Reference: OH-1004 Chr: Chr05 Coordinates: 105607699-105608302 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

294 bp · LXL04_025079|LXL04_025079|OH1004|cDNA

ATGGCAAAGCGTCTGATCCCATGTCTTAACAGAGTTTTGGTGGAGAAGATAGTTCCTCCGTCCAAAACCACCGGTGGTATTCTTCTCCCTGAGAAATCTTCCAAGTTGAATTCCGGTAAAGTGGTGGCTGTTGGTCCAGGAACCCGTGACGATTCCGGAAAAACGATTCCGGTTGCTGTTAAGGAAGGAGACACAGTTTTGTTGCCGGAGTATGGTGGCATGGAAGTAAAGCTGGGTGAAAAAGAGTATCATTTGTTTAG...

CDS

Download CDS FASTA

294 bp · LXL04_025079|LXL04_025079|OH1004|CDS

ATGGCAAAGCGTCTGATCCCATGTCTTAACAGAGTTTTGGTGGAGAAGATAGTTCCTCCGTCCAAAACCACCGGTGGTATTCTTCTCCCTGAGAAATCTTCCAAGTTGAATTCCGGTAAAGTGGTGGCTGTTGGTCCAGGAACCCGTGACGATTCCGGAAAAACGATTCCGGTTGCTGTTAAGGAAGGAGACACAGTTTTGTTGCCGGAGTATGGTGGCATGGAAGTAAAGCTGGGTGAAAAAGAGTATCATTTGTTTAG...

Protein

Download Protein FASTA

97 aa · LXL04_025079|LXL04_025079|OH1004|PROTEIN

MAKRLIPCLNRVLVEKIVPPSKTTGGILLPEKSSKLNSGKVVAVGPGTRDDSGKTIPVAVKEGDTVLLPEYGGMEVKLGEKEYHLFRDEDILGTLHD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025079`
TK1151 ID	TkA06G081670
OH-1004 ID	LXL04_025079
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025079

Location Chr05:105607699-105608302 (+)

Description Similar to CPN10: 10 kDa chaperonin, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14980`	Seems to function only as a co-chaperone, along with CPN60, and in certain cases is essential for the discharge of biologically active proteins from CPN60.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025079 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0044183 protein folding chaperone Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G14980

ola:100049361

spo:2539489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.427

Rank 1 · LXL04_025079 · OH-1004

Nucleus0.352

Rank 2 · LXL04_025079 · OH-1004

Mitochondrion0.247

Rank 3 · LXL04_025079 · OH-1004

Plastid0.054

Rank 4 · LXL04_025079 · OH-1004

Cell membrane0.039

Rank 5 · LXL04_025079 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00166.27Cpn105-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025079	`PF00166.27`	Cpn10	5	94	5.1e-26	91.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P34893`	Arabidopsis thaliana	10 kDa chaperonin, mitochondrial	76.289%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card