LXL04_024967 | RubberDandelionOmics

Gene overview

LXL04_024967

Reference: OH-1004 Chr: Chr05 Coordinates: 103017622-103018559 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · LXL04_024967|LXL04_024967|OH1004|cDNA

ATGTCTGGAAGGAACCGTATGCCTCGAGGTCCCCGTGAGGGCCCAATTCCCCCAATGCACCGGGGTCCCGTCCCCCTCCCTCCTCACCCTGCTACCCTCGAAGAAGAACTTGAACTTCAACATCGAGACATCCAACGAATCATGGTTGAAAACGGACACGTAGTAGAAGAAAACGTGAGTCTTCAAAGGGAATTAACTGCTGTGAAAGAAGAGATCCATCGATTAGGTCAAATCATCCCCAAATTACACGCCGACAAAGA...

CDS

Download CDS FASTA

762 bp · LXL04_024967|LXL04_024967|OH1004|CDS

ATGTCTGGAAGGAACCGTATGCCTCGAGGTCCCCGTGAGGGCCCAATTCCCCCAATGCACCGGGGTCCCGTCCCCCTCCCTCCTCACCCTGCTACCCTCGAAGAAGAACTTGAACTTCAACATCGAGACATCCAACGAATCATGGTTGAAAACGGACACGTAGTAGAAGAAAACGTGAGTCTTCAAAGGGAATTAACTGCTGTGAAAGAAGAGATCCATCGATTAGGTCAAATCATCCCCAAATTACACGCCGACAAAGA...

Protein

Download Protein FASTA

253 aa · LXL04_024967|LXL04_024967|OH1004|PROTEIN

MSGRNRMPRGPREGPIPPMHRGPVPLPPHPATLEEELELQHRDIQRIMVENGHVVEENVSLQRELTAVKEEIHRLGQIIPKLHADKDARARDLIDRGMKLEAELRDSEPLMADVRQLRGEAQKLNSMRQELSGQVQTLTKDTSRLKAENEQVVALKSDIDGMRKDLVDMRGDYEMMKKTNEEHMIQKEAMESNLISMAREIEKLRGEQMRTRGLGGGGYGMLSGSPDMRYPGGGYGGGGGGWGSYDHRGPPRH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024967`
TK1151 ID	TkA06G092950
OH-1004 ID	LXL04_024967
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024967

Location Chr05:103017622-103018559 (-)

Description Similar to FLXL3: Protein FLX-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55170`	Has no transcriptional activation activity.	No verified direct reference in this release
`At3g14750`	Has no transcriptional activation activity.	No verified direct reference in this release
`At1g67170`	Has no transcriptional activation activity.	No verified direct reference in this release
`At2g30120`	Transactivator required for FRIGIDA-mediated activation of FLC and for the expression of the repressors of flowering AGL27/MAF1 and AGL31/MAF2.	No verified direct reference in this release
`At5g61920`	Involved in FLC activation and flowering time control, but has no transcriptional activation activity.	Two FLX family members are non-redundantly required to establish the vernalization requirement in Arabidopsis.2013 · DOI: 10.1038/ncomms3186

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024967 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016604 nuclear body Cellular Component

KEGG gene cross-reference

ath:AT1G55170

ath:AT1G67170

ath:AT2G30120

ath:AT3G14750

ath:AT5G61920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · LXL04_024967 · OH-1004

Cytoplasm0.282

Rank 2 · LXL04_024967 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_024967 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_024967 · OH-1004

Mitochondrion0.014

Rank 5 · LXL04_024967 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C717`	Arabidopsis thaliana	Protein FLX-like 3	37.405%	Swiss-Prot	moderate database homology
`Q93V84`	Arabidopsis thaliana	Protein FLX-like 1	32.967%	Swiss-Prot	moderate database homology
`Q84TD8`	Arabidopsis thaliana	Protein FLX-like 2	33.023%	Swiss-Prot	moderate database homology
`F4IMQ0`	Arabidopsis thaliana	Protein FLC EXPRESSOR	28.090%	Swiss-Prot	weak database homology
`Q9FH51`	Arabidopsis thaliana	Protein FLX-like 4	26.984%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card