LXL04_024919 | RubberDandelionOmics

Gene overview

LXL04_024919

Reference: OH-1004 Chr: Chr05 Coordinates: 102175523-102177505 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1156 bp · LXL04_024919|LXL04_024919|OH1004|cDNA

CGTCGTGTAGACGTGGCCACATTTGTAACCAGATTCTTATGGCGAGGGAGTGTTACCGACTCAAAGCCCTGCCACGACAATCAATTCCCGCTCACCCACCGCCGGAAACTTCTTTATAAACCTCGACTTTCGTCAGCTATTCCTCGCAGACTTCTGTGATCCGATAGCTATAATGGGGGTCAATGAGCTAAACGATAGTAAACCAATGGTGGTTATCAATAAACTCAAGTTCACCTACCCTGGGATCGACGGCCATCCGC...

CDS

Download CDS FASTA

984 bp · LXL04_024919|LXL04_024919|OH1004|CDS

ATGGGGGTCAATGAGCTAAACGATAGTAAACCAATGGTGGTTATCAATAAACTCAAGTTCACCTACCCTGGGATCGACGGCCATCCGCCTCCTGGTTCAGTTCCTCTCATCCAGGATTTCTCCCTAACTCTCAACGCCGGTGATCGTTTCCTTCTCGTCGGAGCTAATGGCGCTGGAAAAACGACGATACTGAAGATACTGGGAGGGAAGCACATGGTGGATCCTGATATGGTTAGGGTTCTTGGCAGATCGGCTTTCCA...

Protein

Download Protein FASTA

327 aa · LXL04_024919|LXL04_024919|OH1004|PROTEIN

MGVNELNDSKPMVVINKLKFTYPGIDGHPPPGSVPLIQDFSLTLNAGDRFLLVGANGAGKTTILKILGGKHMVDPDMVRVLGRSAFHDTSLTSSGDLAYLGGEWRREVAFAGFDVAIQMDISAEKMLFGVSGVDPQRRAELIKVLDVDLSWRMHKVSDGQRRRVQICMGLLKEFKVLLLDEITVDLDVLARADLLTFLKKECEERGATIIYATHIFDGLENWPSHIVYVAQGKLQLALPMEEVRKMSNLSLMRTVEKWLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024919`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024919

Location Chr05:102175523-102177505 (-)

Description Similar to ABCI20: ABC transporter I family member 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02270`	ABC transporter I family member 20.	No verified direct reference in this release
`At5g44110`	ABC transporter I family member 21.	No verified direct reference in this release
`At1g03905`	ABC transporter I family member 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024919 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010114 response to red light Biological Process

GO:0010218 response to far red light Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030014 CCR4-NOT complex Cellular Component

GO:0030015 CCR4-NOT core complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G03905

ath:AT5G02270

ath:AT5G44110

sce:YFL028C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · LXL04_024919 · OH-1004

Nucleus0.386

Rank 2 · LXL04_024919 · OH-1004

Mitochondrion0.095

Rank 3 · LXL04_024919 · OH-1004

Cell membrane0.058

Rank 4 · LXL04_024919 · OH-1004

Endoplasmic reticulum0.043

Rank 5 · LXL04_024919 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran38-183 aa

PF13304.13AAA_21151-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024919	`PF00005.34`	ABC_tran	38	183	3.4e-18	67.3
LXL04_024919	`PF13304.13`	AAA_21	151	214	3.9e-13	50.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ98`	Arabidopsis thaliana	ABC transporter I family member 20	83.810%	Swiss-Prot	strong database homology
`Q9XF19`	Arabidopsis thaliana	ABC transporter I family member 21	59.036%	Swiss-Prot	strong database homology
`Q3EDJ0`	Arabidopsis thaliana	ABC transporter I family member 19	61.739%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card