LXL04_024827 | RubberDandelionOmics

Gene overview

LXL04_024827

Reference: OH-1004 Chr: Chr05 Coordinates: 99617950-99619647 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_024827|LXL04_024827|OH1004|cDNA

ATGTCATTAACCAAGCTCTGTGGAAGAACCTCCCAGTTGTCTTCCCTGCGCAAAACCCTAAACCGCACCCCTGACAGCTCGAGGTCTCTACTCGAAGTCGGACAAAGAAGATATAGTTTTGTGGGAGCTAGCTGTTCAAAACCTAGCCAATTCTACTCACAAATTCGAAATCTCACCTCTGGATCTTCAATTAGTAGGAACTCCTTTAACAGATCTTCTCATTTGGGAATTGGGTACTTGAAGACACCTTTGGGTTCTCA...

CDS

Download CDS FASTA

846 bp · LXL04_024827|LXL04_024827|OH1004|CDS

ATGTCATTAACCAAGCTCTGTGGAAGAACCTCCCAGTTGTCTTCCCTGCGCAAAACCCTAAACCGCACCCCTGACAGCTCGAGGTCTCTACTCGAAGTCGGACAAAGAAGATATAGTTTTGTGGGAGCTAGCTGTTCAAAACCTAGCCAATTCTACTCACAAATTCGAAATCTCACCTCTGGATCTTCAATTAGTAGGAACTCCTTTAACAGATCTTCTCATTTGGGAATTGGGTACTTGAAGACACCTTTGGGTTCTCA...

Protein

Download Protein FASTA

281 aa · LXL04_024827|LXL04_024827|OH1004|PROTEIN

MSLTKLCGRTSQLSSLRKTLNRTPDSSRSLLEVGQRRYSFVGASCSKPSQFYSQIRNLTSGSSISRNSFNRSSHLGIGYLKTPLGSHRQYVTNVIREQKSQKMLYYLTGLVFAMVGCTYAAVPLYRRFCQATGYGGTVQRRETVEEKIARHTQDGTVTNREIVVHFNADVSDGMPWKFIPTQREVRVKPGESALAFYTAENRSSTPITGMSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024827`
TK1151 ID	TkA06G105180
OH-1004 ID	LXL04_024827
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024827

Location Chr05:99617950-99619647 (+)

Description Similar to COX11: Cytochrome c oxidase assembly protein COX11, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02410`	Assembly factor for cytochrome c oxidase (respiratory chain complex IV, CIV).	The Arabidopsis COX11 Homolog is Essential for Cytochrome c Oxidase Activity.2015 · DOI: 10.3389/fpls.2015.01091 The mitochondrial copper chaperone COX11 has an additional role in cellular redox homeostasis.2021 · DOI: 10.1371/journal.pone.0261465

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XLF5`	Assembly factor for cytochrome c oxidase (respiratory chain complex IV, CIV) (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024827 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006754 ATP biosynthetic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0010101 post-embryonic root morphogenesis Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0033132 negative regulation of glucokinase activity Biological Process

GO:0033617 mitochondrial respiratory chain complex IV assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

KEGG gene cross-reference

ath:AT1G02410

bta:510509

mmu:69802

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.942

Rank 1 · LXL04_024827 · OH-1004

Nucleus0.036

Rank 2 · LXL04_024827 · OH-1004

Cytoplasm0.027

Rank 3 · LXL04_024827 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_024827 · OH-1004

Plastid0.010

Rank 5 · LXL04_024827 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04442.20CtaG_Cox11121-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024827	`PF04442.20`	CtaG_Cox11	121	275	4e-61	206.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWR0`	Arabidopsis thaliana	Cytochrome c oxidase assembly protein COX11, mitochondrial	64.828%	Swiss-Prot	strong database homology
`A2XLF5`	Oryza sativa subsp. indica	Cytochrome c oxidase assembly protein COX11, mitochondrial	82.320%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card