LXL04_024800 | RubberDandelionOmics

Gene overview

LXL04_024800

Reference: OH-1004 Chr: Chr05 Coordinates: 99121400-99123367 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1871 bp · LXL04_024800|LXL04_024800|OH1004|cDNA

ATCACAAAACATAACACATATATCTCTCTATCAACCTCACAAACTTTTTCTGCAACCAAAACATACCAAGTACTTACTTTCAGgcaatctatatatatacgtcaATTAAATCTATTAAAGTATTAATGGAGAGACTTCCTAAGTGTCCAGCAAACTATGTCCCCCTCACTCCTCTCACTTTCATCAAGAGAGCTTCCATGGTTTATTCCAACCGTACCTCCATCATCTATGGCGGTGTCAGCTTCACTTGGCGCCAAACT...

CDS

Download CDS FASTA

1746 bp · LXL04_024800|LXL04_024800|OH1004|CDS

ATGGAGAGACTTCCTAAGTGTCCAGCAAACTATGTCCCCCTCACTCCTCTCACTTTCATCAAGAGAGCTTCCATGGTTTATTCCAACCGTACCTCCATCATCTATGGCGGTGTCAGCTTCACTTGGCGCCAAACTTATGAGAGATGCTGTCGTCTTGCCTACTCCCTCCGCTCCCTTAACGTTGTCAAAAACGATGTCGTATCTGTGTTAGCACCAAACGTACCGGCGTTATACGAGATGCATTTCGCAGTGCCAATGGC...

Protein

Download Protein FASTA

581 aa · LXL04_024800|LXL04_024800|OH1004|PROTEIN

MERLPKCPANYVPLTPLTFIKRASMVYSNRTSIIYGGVSFTWRQTYERCCRLAYSLRSLNVVKNDVVSVLAPNVPALYEMHFAVPMAGAVLNAMNTRLDAKNIATILCHSEAKVFFVDYQYVPLASEALQMLDNRNVPMPLVIVVDDVDKPTGVRLGELEYELLVSHGNPLYQGEELEDEWDAISLNYTSGTTSEPKGVVYSHRGAFLSTMSLIQGWEMGTEAVYMWSLPMFHCNGWTFTWGVAARGGTNVCIRNTTAEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024800`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024800

Location Chr05:99121400-99123367 (-)

Description Similar to AAE12: Probable acyl-activating enzyme 12, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65890`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release
`At1g65880`	Benzoate--CoA ligase involved in benzoyloxyglucosinolate biosynthesis in seeds.	Characterization of seed-specific benzoyloxyglucosinolate mutations in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03205.x
`At1g66120`	Butyrate--CoA ligase that is active in vitro with medium-chain fatty acids, with a preference for hexanoate and octanoate.	No verified direct reference in this release
`At1g20560`	Catalyzes the ligation of CoA on butanoate to produce butanoyl-CoA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024800 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009800 cinnamic acid biosynthetic process Biological Process

GO:0009803 cinnamic acid metabolic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0019605 butyrate metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0052315 phytoalexin biosynthetic process Biological Process

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G20560

ath:AT1G65880

ath:AT1G65890

ath:AT1G66120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.472

Rank 1 · LXL04_024800 · OH-1004

Cytoplasm0.258

Rank 2 · LXL04_024800 · OH-1004

Mitochondrion0.186

Rank 3 · LXL04_024800 · OH-1004

Nucleus0.076

Rank 4 · LXL04_024800 · OH-1004

Cell membrane0.052

Rank 5 · LXL04_024800 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding24-402 aa

PF13193.13AMP-binding_C452-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024800	`PF00501.35`	AMP-binding	24	402	4.4e-79	266.8
LXL04_024800	`PF13193.13`	AMP-binding_C	452	527	2.2e-25	90.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS00`	Arabidopsis thaliana	Probable acyl-activating enzyme 12, peroxisomal	60.670%	Swiss-Prot	strong database homology
`Q9SS01`	Arabidopsis thaliana	Benzoate--CoA ligase, peroxisomal	59.930%	Swiss-Prot	strong database homology
`Q9C8D4`	Arabidopsis thaliana	Butyrate--CoA ligase AAE11, peroxisomal	60.644%	Swiss-Prot	strong database homology
`F4HUK6`	Arabidopsis thaliana	Butanoate--CoA ligase AAE1	50.735%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card