LXL04_024725 | RubberDandelionOmics

Gene overview

LXL04_024725

Reference: OH-1004 Chr: Chr05 Coordinates: 97467304-97471119 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2430 bp · LXL04_024725|LXL04_024725|OH1004|cDNA

ATGAATTACACCTTGCTTCGCTCTCTATTTGCCAATTTCTTGTTCTCCCTGTTGATATGTGGATCGATTGTCAGCGTTCACAACTTGGAAATCTCGAAGGTCGATCATGCACCAGCGAAGCGGTCTCTATTGTCTTTTCCGGATAAACACGACACCGCCCTTGTTGCTACATTGGATGGCACAATCAATTTGGTGTACCGTGATTCTGGgagggtaatttggtcatttgGATCAGGATCCCCAATCTACTCTTCCTACCA...

CDS

Download CDS FASTA

2430 bp · LXL04_024725|LXL04_024725|OH1004|CDS

ATGAATTACACCTTGCTTCGCTCTCTATTTGCCAATTTCTTGTTCTCCCTGTTGATATGTGGATCGATTGTCAGCGTTCACAACTTGGAAATCTCGAAGGTCGATCATGCACCAGCGAAGCGGTCTCTATTGTCTTTTCCGGATAAACACGACACCGCCCTTGTTGCTACATTGGATGGCACAATCAATTTGGTGTACCGTGATTCTGGGAGGGTAATTTGGTCATTTGGATCAGGATCCCCAATCTACTCTTCCTACCA...

Protein

Download Protein FASTA

809 aa · LXL04_024725|LXL04_024725|OH1004|PROTEIN

MNYTLLRSLFANFLFSLLICGSIVSVHNLEISKVDHAPAKRSLLSFPDKHDTALVATLDGTINLVYRDSGRVIWSFGSGSPIYSSYQAPITHDDDDENVTLPGNSYYVDCADDWKLYAHTAIGKVSMDMTMEEFIRIMPHVSEDGGVILGSKKTTAFVVDAHTGRLIRVHHTSSTNEHSNSIIQKSTMVNEKPDKQFSFTRTDYLLTSFAPNSNKVLWNVTLADIDVALLCPSLSLPNNPRSKSIVDFDFDFDLPMPCQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024725`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024725

Location Chr05:97467304-97471119 (-)

Description Similar to IRE1B: Serine/threonine-protein kinase/endoribonuclease IRE1b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24360`	Senses unfolded proteins in the lumen of the endoplasmic reticulum via its N-terminal domain which leads to enzyme auto- activation.	Heat induces the splicing by IRE1 of a mRNA encoding a transcription factor involved in the unfolded protein response in Arabidopsis.2011 · DOI: 10.1073/pnas.1102117108 AtIRE1A/AtIRE1B and AGB1 independently control two essential unfolded protein response pathways in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04788.x Arabidopsis IRE1 catalyses unconventional splicing of bZIP60 mRNA to produce the active transcription factor.2011 · DOI: 10.1038/srep00029 IRE1/bZIP60-mediated unfolded protein response plays distinct roles in plant immunity and abiotic stress responses.2012 · DOI: 10.1371/journal.pone.0031944 Alteration of the bZIP60/IRE1 pathway affects plant response to ER stress in Arabidopsis thaliana.2012 · DOI: 10.1371/journal.pone.0039023 Degradation of the endoplasmic reticulum by autophagy during endoplasmic reticulum stress in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101535
`At3g11870`	Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0471000`	Involved in endoplasmic reticulum (ER) stress response.	Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice.2012 · DOI: 10.1111/j.1365-313x.2011.04844.x Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.2012 · DOI: 10.1093/mp/ssr115

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024725 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process

GO:0002376 immune system process Biological Process

GO:0006020 inositol metabolic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006914 autophagy Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034067 protein localization to Golgi apparatus Biological Process

GO:0034263 positive regulation of autophagy in response to ER overload Biological Process

KEGG gene cross-reference

ath:AT3G11870

ath:AT5G24360

dosa:Os07g0471000

sce:YHR079C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.493

Rank 1 · LXL04_024725 · OH-1004

Golgi apparatus0.169

Rank 2 · LXL04_024725 · OH-1004

Nucleus0.153

Rank 3 · LXL04_024725 · OH-1004

Cytoplasm0.142

Rank 4 · LXL04_024725 · OH-1004

Cell membrane0.074

Rank 5 · LXL04_024725 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase403-675 aa

PF07714.24PK_Tyr_Ser-Thr404-667 aa

PF06479.18Ribonuc_2-5A681-806 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024725	`PF00069.32`	Pkinase	403	675	1.6e-35	123.5
LXL04_024725	`PF07714.24`	PK_Tyr_Ser-Thr	404	667	2.4e-23	83.5
LXL04_024725	`PF06479.18`	Ribonuc_2-5A	681	806	1.4e-44	152.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VJ2`	Arabidopsis thaliana	Serine/threonine-protein kinase/endoribonuclease IRE1b	63.063%	Swiss-Prot	moderate database homology
`Q9SF12`	Arabidopsis thaliana	Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like	42.650%	Swiss-Prot	moderate database homology
`Q7XIT1`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase/endoribonuclease IRE1	59.036%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card