LXL04_024682 | RubberDandelionOmics

Gene overview

LXL04_024682

Reference: OH-1004 Chr: Chr05 Coordinates: 96645219-96646922 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · LXL04_024682|LXL04_024682|OH1004|cDNA

ATGGCCGCAGCATGGGAACATTTCGGAGAGATTGCAAATGTGGCCCAATTAACAGGTCTGGATGCAGTCAGACTAATCGGAATGATCGTTCAAGCCGCCAGCACAGCTCGTTTGCACAAAAAGAACTGCAAACAATTTGCAATGCATTTAAAATTGATCGGAAATCTTCTACAACAACTCAAAATCAGTGAGCTCAAAAGGTATCCAGAAACACGCGAGCCTCTAGAACAACTTGAAGACGCACTTAGAAGATCGTACAT...

CDS

Download CDS FASTA

1236 bp · LXL04_024682|LXL04_024682|OH1004|CDS

ATGGCCGCAGCATGGGAACATTTCGGAGAGATTGCAAATGTGGCCCAATTAACAGGTCTGGATGCAGTCAGACTAATCGGAATGATCGTTCAAGCCGCCAGCACAGCTCGTTTGCACAAAAAGAACTGCAAACAATTTGCAATGCATTTAAAATTGATCGGAAATCTTCTACAACAACTCAAAATCAGTGAGCTCAAAAGGTATCCAGAAACACGCGAGCCTCTAGAACAACTTGAAGACGCACTTAGAAGATCGTACAT...

Protein

Download Protein FASTA

411 aa · LXL04_024682|LXL04_024682|OH1004|PROTEIN

MAAAWEHFGEIANVAQLTGLDAVRLIGMIVQAASTARLHKKNCKQFAMHLKLIGNLLQQLKISELKRYPETREPLEQLEDALRRSYILVNSCQDRSYLYLLAMGWNIVYQFRKAQNEIDRYLKIIPLITLVDNARVRERLEYIEMDQREYTLDDEDRKVQDVIMKPDPSHNDTVVLKKTLSCSYPNLPFKEAIKTENEKLHMELQRSQANLDVGQCEVIQHLIEVTQVVASKSQHEQDSPKKNNMQMVVAETQYPDVKSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024682`
TK1151 ID	TkA06G117460
OH-1004 ID	LXL04_024682
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024682

Location Chr05:96645219-96646922 (+)

Description Similar to MCA1: Protein MID1-COMPLEMENTING ACTIVITY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35920`	Calcium-permeable stretch-activated channel component.	Arabidopsis plasma membrane protein crucial for Ca2+ influx and touch sensing in roots.2007 · DOI: 10.1073/pnas.0607703104 MCA1 and MCA2 that mediate Ca2+ uptake have distinct and overlapping roles in Arabidopsis.2010 · DOI: 10.1104/pp.109.147371
`At2g17780`	Calcium-permeable stretch-activated channel component.	MCA1 and MCA2 that mediate Ca2+ uptake have distinct and overlapping roles in Arabidopsis.2010 · DOI: 10.1104/pp.109.147371
`At3g18470`	May be involved in heavy metals transport.	No verified direct reference in this release
`At1g14870`	Zinc transporter acting in both zinc extrusion and long-distance zinc transport.	Arabidopsis PCR2 is a zinc exporter involved in both zinc extrusion and long-distance zinc transport.2010 · DOI: 10.1105/tpc.109.070185

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0007231 osmosensory signaling pathway Biological Process

GO:0033500 carbohydrate homeostasis Biological Process

GO:0048528 post-embryonic root development Biological Process

GO:0071260 cellular response to mechanical stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G14870

ath:AT2G17780

ath:AT3G18470

ath:AT4G35920

zma:100192784

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.660

Rank 1 · LXL04_024682 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_024682 · OH-1004

Nucleus0.120

Rank 3 · LXL04_024682 · OH-1004

Endoplasmic reticulum0.103

Rank 4 · LXL04_024682 · OH-1004

Lysosome / Vacuole0.075

Rank 5 · LXL04_024682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19584.4MCAfunc25-166 aa

PF04749.23PLAC8290-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024682	`PF19584.4`	MCAfunc	25	166	3.2e-83	277.3
LXL04_024682	`PF04749.23`	PLAC8	290	387	6.2e-20	72.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7E9`	Arabidopsis thaliana	Protein MID1-COMPLEMENTING ACTIVITY 1	67.612%	Swiss-Prot	strong database homology
`Q3EBY6`	Arabidopsis thaliana	Protein MID1-COMPLEMENTING ACTIVITY 2	61.268%	Swiss-Prot	strong database homology
`Q9LS43`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 7	32.576%	Swiss-Prot	weak database homology
`Q9LQU4`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 2	38.679%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card