Gene Card
Gene overview
cDNA / CDS / Protein Sequences
768 bp · LXL04_024666|LXL04_024666|OH1004|cDNA
ATGGCGGAGGAAGCATCCACGGGGGTAGTGATTCGGTTCCATGCAGCCAAGGGTTTTGGGTTTATCAAGCCAGATGAAGGCGGCGAAGATCTGTTTGTTCATCAATCAGAGATTCAATCTGACGGCTACCGTAGCCTCCAGGATGGTCAGAAGGTCAAGTTTCTAGTTGTCGAGAAGAACGATCGGAAGCAAGCTGTGAATGTTGCCAGTTTGGATGGAACTACCGTTGACAGAAACCGTAATCGCGATGGTTACGGTGG...
768 bp · LXL04_024666|LXL04_024666|OH1004|CDS
ATGGCGGAGGAAGCATCCACGGGGGTAGTGATTCGGTTCCATGCAGCCAAGGGTTTTGGGTTTATCAAGCCAGATGAAGGCGGCGAAGATCTGTTTGTTCATCAATCAGAGATTCAATCTGACGGCTACCGTAGCCTCCAGGATGGTCAGAAGGTCAAGTTTCTAGTTGTCGAGAAGAACGATCGGAAGCAAGCTGTGAATGTTGCCAGTTTGGATGGAACTACCGTTGACAGAAACCGTAATCGCGATGGTTACGGTGG...
Protein
Download Protein FASTA255 aa · LXL04_024666|LXL04_024666|OH1004|PROTEIN
MAEEASTGVVIRFHAAKGFGFIKPDEGGEDLFVHQSEIQSDGYRSLQDGQKVKFLVVEKNDRKQAVNVASLDGTTVDRNRNRDGYGGGGRRGGGDGHGFTRVGAGGYNDGGGFRGNNGNGGGYRSGGGGGGRECYNCGGVGHIARDCSSSAGAGGGGGGCYNCGGPGHLARDCSRGRGGNGGGGGGCYTCGEPGHMARDCTSGGSGGGGSGGGGRGLSRGGGGGGGGYRSGGGGGGNCYHCGEPGHFARECRANA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_024666 |
|---|---|
| TK1151 ID | TkA06G119250 |
| OH-1004 ID | LXL04_024666 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 70.200 |
| Protein coverage (%) | TK1151 57.339 / OH-1004 59.216Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_024666 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:96319947-96320714 (+) | |||||||||
| Description | Similar to CSP1: Cold shock protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009651 response to salt stress Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0071919 G-quadruplex DNA formation Biological Process GO:2000767 positive regulation of cytoplasmic translation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G17870 ath:AT4G36020 bta:504831 gga:395731 mmu:12785 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00313.29CSD7-69 aaPF00098.29zf-CCHC133-148 aaPF00098.29zf-CCHC159-174 aaPF00098.29zf-CCHC186-202 aaPF00098.29zf-CCHC237-252 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_024666 | PF00313.29 | CSD | 7 | 69 | 9.8e-24 | 83.7 |
| LXL04_024666 | PF00098.29 | zf-CCHC | 133 | 148 | 9.9e-32 | 108.3 |
| LXL04_024666 | PF00098.29 | zf-CCHC | 159 | 174 | 9.9e-32 | 108.3 |
| LXL04_024666 | PF00098.29 | zf-CCHC | 186 | 202 | 9.9e-32 | 108.3 |
| LXL04_024666 | PF00098.29 | zf-CCHC | 237 | 252 | 9.9e-32 | 108.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.