LXL04_024647 | RubberDandelionOmics

Gene overview

LXL04_024647

Reference: OH-1004 Chr: Chr05 Coordinates: 95940364-95940999 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · LXL04_024647|LXL04_024647|OH1004|cDNA

ATGTCGTCTTCTTCGTCTGATAAGGTTAGGGCTTCGCACATACTGATAAAGCACCAAGGATCTCGTCGTAAGGCTTCCTGGAAGGATCCAGAAGGTCGTATCATCAGCAGCACCACAAGAGAGGCTGCTGTCTCTCAGCTCACATCACTCCGCGATGACATCGTTACTGGAAAGTCCAAGTTCGAGGATGTCGCTTCTCGTTACTCCGATTGCAGCTCGGCTAAGCGCGGTGGAGATCTAGGATCATTTGGAAGGAACCA...

CDS

Download CDS FASTA

366 bp · LXL04_024647|LXL04_024647|OH1004|CDS

ATGTCGTCTTCTTCGTCTGATAAGGTTAGGGCTTCGCACATACTGATAAAGCACCAAGGATCTCGTCGTAAGGCTTCCTGGAAGGATCCAGAAGGTCGTATCATCAGCAGCACCACAAGAGAGGCTGCTGTCTCTCAGCTCACATCACTCCGCGATGACATCGTTACTGGAAAGTCCAAGTTCGAGGATGTCGCTTCTCGTTACTCCGATTGCAGCTCGGCTAAGCGCGGTGGAGATCTAGGATCATTTGGAAGGAACCA...

Protein

Download Protein FASTA

121 aa · LXL04_024647|LXL04_024647|OH1004|PROTEIN

MSSSSSDKVRASHILIKHQGSRRKASWKDPEGRIISSTTREAAVSQLTSLRDDIVTGKSKFEDVASRYSDCSSAKRGGDLGSFGRNQMQKPFEDATYALKVGEISEIVDTDSGVHIILRTC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024647`
TK1151 ID	TkA06G121220
OH-1004 ID	LXL04_024647
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024647

Location Chr05:95940364-95940999 (-)

Description Similar to PIN1: Peptidyl-prolyl cis-trans isomerase Pin1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18040`	Prolyl cis/trans isomerase with specificity for phospho-Ser-Pro bonds.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024647 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006369 termination of RNA polymerase II transcription Biological Process

GO:0009630 gravitropism Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0032880 regulation of protein localization Biological Process

GO:0045899 positive regulation of RNA polymerase II transcription preinitiation complex assembly Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway Biological Process

GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process

GO:2000749 positive regulation of rDNA heterochromatin formation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G18040

dme:Dmel_CG17051

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · LXL04_024647 · OH-1004

Nucleus0.346

Rank 2 · LXL04_024647 · OH-1004

Mitochondrion0.153

Rank 3 · LXL04_024647 · OH-1004

Plastid0.098

Rank 4 · LXL04_024647 · OH-1004

Peroxisome0.059

Rank 5 · LXL04_024647 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13616.13Rotamase_34-117 aa

PF00639.28Rotamase13-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024647	`PF13616.13`	Rotamase_3	4	117	1.1e-21	78.2
LXL04_024647	`PF00639.28`	Rotamase	13	118	7.7e-25	88.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL42`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase Pin1	80.508%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card