LXL04_024609 | RubberDandelionOmics

Gene overview

LXL04_024609

Reference: OH-1004 Chr: Chr05 Coordinates: 95129439-95138806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3618 bp · LXL04_024609|LXL04_024609|OH1004|cDNA

ATGGCGTCTCGAAATTTCCCGGAGATGCCCACGCCGTCGTCTCTGCTGTCGGCGTACGCCTCAATGTCAACGTCAATCATGCTCTTCCGGACAATGTTTGACCAGCTCTTCCCCAGACACCTCCGACGCTACGTCTTAGACGCCGTCCGATTCTACTGGAAACCAAAATCCTCAAACCTCACTCTCGTCTTCGAGGAGAAAGATGGCATGACCATAAACCATATGTACAATGTCGCCGAAGCCTTCCTATGTTCCCAAAT...

CDS

Download CDS FASTA

3618 bp · LXL04_024609|LXL04_024609|OH1004|CDS

ATGGCGTCTCGAAATTTCCCGGAGATGCCCACGCCGTCGTCTCTGCTGTCGGCGTACGCCTCAATGTCAACGTCAATCATGCTCTTCCGGACAATGTTTGACCAGCTCTTCCCCAGACACCTCCGACGCTACGTCTTAGACGCCGTCCGATTCTACTGGAAACCAAAATCCTCAAACCTCACTCTCGTCTTCGAGGAGAAAGATGGCATGACCATAAACCATATGTACAATGTCGCCGAAGCCTTCCTATGTTCCCAAAT...

Protein

Download Protein FASTA

1205 aa · LXL04_024609|LXL04_024609|OH1004|PROTEIN

MASRNFPEMPTPSSLLSAYASMSTSIMLFRTMFDQLFPRHLRRYVLDAVRFYWKPKSSNLTLVFEEKDGMTINHMYNVAEAFLCSQINPDSDRLRITKNVKEPHINIKFAESAEVVDSFEGISLTWKYVHHQQKQSPDGGGDDFVHGGGRYSGAGGSSSPERKYIELKFDKKYKEIIISSYLPLIIKKSQELENQKKVVKLHNLQSYGCGPGGSNESVNLDHPSTFETLAMDPKMKKAIIDDLDLFLRRRDFYRRVGKAW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024609`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024609

Location Chr05:95129439-95138806 (-)

Description Similar to At2g18190: AAA-ATPase At2g18190

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18190`	AAA-ATPase At2g18190.	No verified direct reference in this release
`At5g17760`	AAA-ATPase At5g17760.	No verified direct reference in this release
`At2g18193`	AAA-ATPase At2g18193.	No verified direct reference in this release
`At5g17740`	AAA-ATPase At5g17740.	No verified direct reference in this release
`At3g50930`	Protein HYPER-SENSITIVITY-RELATED 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024609 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT2G18190

ath:AT2G18193

ath:AT5G17760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.369

Rank 1 · LXL04_024609 · OH-1004

Nucleus0.202

Rank 2 · LXL04_024609 · OH-1004

Endoplasmic reticulum0.172

Rank 3 · LXL04_024609 · OH-1004

Mitochondrion0.143

Rank 4 · LXL04_024609 · OH-1004

Cell membrane0.132

Rank 5 · LXL04_024609 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14363.12AAA_assoc37-129 aa

PF00004.36AAA264-398 aa

PF25568.1AAA_lid_At3g28540401-470 aa

PF14363.12AAA_assoc785-866 aa

PF00004.36AAA982-1118 aa

PF25568.1AAA_lid_At3g285401121-1191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024609	`PF14363.12`	AAA_assoc	37	129	9.4e-34	116.4
LXL04_024609	`PF00004.36`	AAA	264	398	8.5e-39	133.7
LXL04_024609	`PF25568.1`	AAA_lid_At3g28540	401	470	2e-42	143.7
LXL04_024609	`PF14363.12`	AAA_assoc	785	866	9.4e-34	116.4
LXL04_024609	`PF00004.36`	AAA	982	1118	8.5e-39	133.7
LXL04_024609	`PF25568.1`	AAA_lid_At3g28540	1121	1191	2e-42	143.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IQG2`	Arabidopsis thaliana	AAA-ATPase At2g18190	48.101%	Swiss-Prot	weak database homology
`Q9FN75`	Arabidopsis thaliana	AAA-ATPase At5g17760	47.976%	Swiss-Prot	weak database homology
`Q8GW96`	Arabidopsis thaliana	AAA-ATPase At2g18193	47.084%	Swiss-Prot	weak database homology
`Q9FN77`	Arabidopsis thaliana	AAA-ATPase At5g17740	42.155%	Swiss-Prot	weak database homology
`Q8VZG2`	Arabidopsis thaliana	Protein HYPER-SENSITIVITY-RELATED 4	46.250%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card