LXL04_024569 | RubberDandelionOmics

Gene overview

LXL04_024569

Reference: OH-1004 Chr: Chr05 Coordinates: 93975486-93976855 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · LXL04_024569|LXL04_024569|OH1004|cDNA

ATGATAAGAGCTGTGATGGTGATCAACAACCAGGGCAAGCCTCGCCTCGCTAAATTCTACAACTATACGCCTGTGGAACAGCAGCAGCAACTAATACGCACTATCTATTCAGTCTTATGCTTGCAGCCTGAAAATGTGAGCAATTTCATTGAAGGGGGCTCCTTATTGGGTCcgGATTCACGGCTTGTTTACAAGCTATTTGCAACATTATACTTTGTGTTCATATTTGATAGCTCTGAAAATGAACTGGCCATGTTTGA...

CDS

Download CDS FASTA

498 bp · LXL04_024569|LXL04_024569|OH1004|CDS

ATGATAAGAGCTGTGATGGTGATCAACAACCAGGGCAAGCCTCGCCTCGCTAAATTCTACAACTATACGCCTGTGGAACAGCAGCAGCAACTAATACGCACTATCTATTCAGTCTTATGCTTGCAGCCTGAAAATGTGAGCAATTTCATTGAAGGGGGCTCCTTATTGGGTCCGGATTCACGGCTTGTTTACAAGCTATTTGCAACATTATACTTTGTGTTCATATTTGATAGCTCTGAAAATGAACTGGCCATGTTTGA...

Protein

Download Protein FASTA

165 aa · LXL04_024569|LXL04_024569|OH1004|PROTEIN

MIRAVMVINNQGKPRLAKFYNYTPVEQQQQLIRTIYSVLCLQPENVSNFIEGGSLLGPDSRLVYKLFATLYFVFIFDSSENELAMFDLIQVYVETLEKCFSNVCELDIVLNYGKMHTILDEMIVGGQVVETNSQNIIKAVEEISKLEKVTVATKLISKSTSLLWG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024569`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024569

Location Chr05:93975486-93976855 (-)

Description Similar to At3g50860: AP-3 complex subunit sigma

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50860`	Part of the AP-3 complex, an adaptor-related complex which seems to be clathrin-associated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024569 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0035654 clathrin-coated vesicle cargo loading, AP-3-mediated Biological Process

GO:0060155 platelet dense granule organization Biological Process

GO:0005769 early endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

GO:0030119 AP-type membrane coat adaptor complex Cellular Component

GO:0030123 AP-3 adaptor complex Cellular Component

GO:0030133 transport vesicle Cellular Component

KEGG gene cross-reference

ath:AT3G50860

bta:508867

bta:536359

hsa:1176

mmu:11777

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · LXL04_024569 · OH-1004

Golgi apparatus0.445

Rank 2 · LXL04_024569 · OH-1004

Lysosome / Vacuole0.166

Rank 3 · LXL04_024569 · OH-1004

Nucleus0.131

Rank 4 · LXL04_024569 · OH-1004

Cell membrane0.113

Rank 5 · LXL04_024569 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01217.27Clat_adaptor_s1-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024569	`PF01217.27`	Clat_adaptor_s	1	146	5e-45	153.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ37`	Arabidopsis thaliana	AP-3 complex subunit sigma	70.186%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card