LXL04_024468 | RubberDandelionOmics

Gene overview

LXL04_024468

Reference: OH-1004 Chr: Chr05 Coordinates: 91541874-91544404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · LXL04_024468|LXL04_024468|OH1004|cDNA

ATGGGGGTTTCCCAAATCGATTCACAACACCCACTTGCCGTGTCGTCATCTTTAGCTTCAATCACCGCCTGCACCACCGCTAATTTTGAAGACGACGAGGAAATCTATCGCTACAATGACGATGGCGACAGAAAATTCAAGAGCTTTCTTCACAAAATGATTTGGGATTTTGggtttgtttgttttttccCAACAGTTACGAAGAAGAAAGATGAAATGAAGAAAAAAATGGTGAACAATTTGGAGAATAACAAGGCGTG...

CDS

Download CDS FASTA

1554 bp · LXL04_024468|LXL04_024468|OH1004|CDS

ATGGGGGTTTCCCAAATCGATTCACAACACCCACTTGCCGTGTCGTCATCTTTAGCTTCAATCACCGCCTGCACCACCGCTAATTTTGAAGACGACGAGGAAATCTATCGCTACAATGACGATGGCGACAGAAAATTCAAGAGCTTTCTTCACAAAATGATTTGGGATTTTGGGTTTGTTTGTTTTTTCCCAACAGTTACGAAGAAGAAAGATGAAATGAAGAAAAAAATGGTGAACAATTTGGAGAATAACAAGGCGTG...

Protein

Download Protein FASTA

517 aa · LXL04_024468|LXL04_024468|OH1004|PROTEIN

MGVSQIDSQHPLAVSSSLASITACTTANFEDDEEIYRYNDDGDRKFKSFLHKMIWDFGFVCFFPTVTKKKDEMKKKMVNNLENNKAWLLAESGGCVAELANAEPHSVHSSFRFSLCSQVELESMSVNSSSATVLMVNLDNGLIEPKSQELKWRRIESLEKSISPIAHNLIRFSYGEILSATRNFSKGRVLGRGALSYVFKGRIGILRTSVAIKKLDKEDKEAPKAFCRELMIASSLHNPFIVPLVGFCIDPEEGLFLIYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024468`
TK1151 ID	TkA06G140230
OH-1004 ID	LXL04_024468
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.361 / OH-1004 59.961 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024468

Location Chr05:91541874-91544404 (-)

Description Similar to PBL7: Probable serine/threonine-protein kinase PBL7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16750`	Promotes cell proliferation in the gibberellic acid (GA) signaling pathway, acting downstream of RGA, and possibly through a negative regulation of two cyclin-dependent kinase inhibitors SIM and SMR1.	No verified direct reference in this release
`At5g57670`	Probable receptor-like serine/threonine-protein kinase At5g57670.	No verified direct reference in this release
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At5g18610`	May act as a receptor-like cytoplasmic kinase in chitin-induced immune signaling.	Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535 The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At5g13160`	Protein kinase required for plant defense mechanism mediated by the disease resistance (R) protein RPS5.	The Arabidopsis PBS1 resistance gene encodes a member of a novel protein kinase subfamily.2001 · DOI: 10.1046/j.1365-313x.2001.01014.x Cleavage of Arabidopsis PBS1 by a bacterial type III effector.2003 · DOI: 10.1126/science.1085671 Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease.2007 · DOI: 10.1073/pnas.0608779104 Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 Activation of a plant nucleotide binding-leucine rich repeat disease resistance protein by a modified self protein.2012 · DOI: 10.1111/j.1462-5822.2012.01779.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024468 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043410 positive regulation of MAPK cascade Biological Process

GO:0045087 innate immune response Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT2G16750

ath:AT5G02800

ath:AT5G13160

ath:AT5G18610

ath:AT5G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.650

Rank 1 · LXL04_024468 · OH-1004

Nucleus0.276

Rank 2 · LXL04_024468 · OH-1004

Cytoplasm0.246

Rank 3 · LXL04_024468 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_024468 · OH-1004

Golgi apparatus0.025

Rank 5 · LXL04_024468 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase185-459 aa

PF07714.24PK_Tyr_Ser-Thr187-461 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024468	`PF00069.32`	Pkinase	185	459	3.3e-44	152.0
LXL04_024468	`PF07714.24`	PK_Tyr_Ser-Thr	187	461	1.1e-40	140.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B5X4Z9`	Arabidopsis thaliana	Protein kinase STUNTED	42.407%	Swiss-Prot	moderate database homology
`Q5XF57`	Arabidopsis thaliana	Probable receptor-like serine/threonine-protein kinase At5g57670	37.846%	Swiss-Prot	moderate database homology
`Q0WRY5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL7	39.932%	Swiss-Prot	moderate database homology
`Q1PDV6`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL27	36.950%	Swiss-Prot	moderate database homology
`Q9FE20`	Arabidopsis thaliana	Serine/threonine-protein kinase PBS1	39.322%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card