LXL04_024358 | RubberDandelionOmics

Gene overview

LXL04_024358

Reference: OH-1004 Chr: Chr05 Coordinates: 88425826-88426891 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · LXL04_024358|LXL04_024358|OH1004|cDNA

ATGTCTGGCGGTATTGCTCGTGGCCGTCTCACCGAGGAACGAAAAGCATGGCGAAAGAATCATCCCCATGGTTTTGTGGCGAAGCCTGATACTCTTCCTGATGGTACAGTGAATTTGATGATTTGGCAGTGTACCATCCCCGGTAAGACTGGGACTGACTGGGAGGGTGGATACTACCCTCTTACCCTCCACTTCACCGAAGACTATCCAAGCAAACCACCAAAGTGTAAATTCCCTCAAGGCTTCTTCCATCCCAATGT...

CDS

Download CDS FASTA

483 bp · LXL04_024358|LXL04_024358|OH1004|CDS

ATGTCTGGCGGTATTGCTCGTGGCCGTCTCACCGAGGAACGAAAAGCATGGCGAAAGAATCATCCCCATGGTTTTGTGGCGAAGCCTGATACTCTTCCTGATGGTACAGTGAATTTGATGATTTGGCAGTGTACCATCCCCGGTAAGACTGGGACTGACTGGGAGGGTGGATACTACCCTCTTACCCTCCACTTCACCGAAGACTATCCAAGCAAACCACCAAAGTGTAAATTCCCTCAAGGCTTCTTCCATCCCAATGT...

Protein

Download Protein FASTA

160 aa · LXL04_024358|LXL04_024358|OH1004|PROTEIN

MSGGIARGRLTEERKAWRKNHPHGFVAKPDTLPDGTVNLMIWQCTIPGKTGTDWEGGYYPLTLHFTEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDSPNPADPAQTDGYHLFIQDTVEYKRRVRLQAKQYPPLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024358`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024358

Location Chr05:88425826-88426891 (-)

Description Similar to SCE1: SUMO-conjugating enzyme SCE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57870`	May catalyze covalent conjugation of SUMO to target proteins.	Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285 The PHD domain of plant PIAS proteins mediates sumoylation of bromodomain GTE proteins.2008 · DOI: 10.1074/jbc.m708176200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024358 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010469 regulation of signaling receptor activity Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0033145 positive regulation of intracellular steroid hormone receptor signaling pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0051168 nuclear export Biological Process

KEGG gene cross-reference

ath:AT3G57870

ddi:DDB_G0287693

rno:25573

xla:108703134

xla:380450

xtr:549162

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.590

Rank 1 · LXL04_024358 · OH-1004

Cytoplasm0.574

Rank 2 · LXL04_024358 · OH-1004

Cell membrane0.074

Rank 3 · LXL04_024358 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_024358 · OH-1004

Mitochondrion0.057

Rank 5 · LXL04_024358 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179.32UQ_con9-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024358	`PF00179.32`	UQ_con	9	151	4.6e-45	153.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42551`	Arabidopsis thaliana	SUMO-conjugating enzyme SCE1	86.250%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card