LXL04_023987 | RubberDandelionOmics

Gene overview

LXL04_023987

Reference: OH-1004 Chr: Chr05 Coordinates: 76992925-76995019 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2010 bp · LXL04_023987|LXL04_023987|OH1004|cDNA

ATGCCTGAACACGTCGGCGACCATTCGACCTCAAATCCGACCGGCGATAACATATCAACCGGCGGTTATGTCCCACACAAAGAGCTTTTCGGCTACTCTTCTCCGAGAAGCCCATTGACCACACTCAGCCCTGAGAGCGATTCAATGGGTTTATCCATTGACAGTCCTGGAGGCGTAGATACCTCCATTGAACAGCTTTATAATAACGTCTGCGAAATGCAAAGCTCCGACCAGTCACCTTCCAGGTTCAGTTACTTATC...

CDS

Download CDS FASTA

2010 bp · LXL04_023987|LXL04_023987|OH1004|CDS

ATGCCTGAACACGTCGGCGACCATTCGACCTCAAATCCGACCGGCGATAACATATCAACCGGCGGTTATGTCCCACACAAAGAGCTTTTCGGCTACTCTTCTCCGAGAAGCCCATTGACCACACTCAGCCCTGAGAGCGATTCAATGGGTTTATCCATTGACAGTCCTGGAGGCGTAGATACCTCCATTGAACAGCTTTATAATAACGTCTGCGAAATGCAAAGCTCCGACCAGTCACCTTCCAGGTTCAGTTACTTATC...

Protein

Download Protein FASTA

669 aa · LXL04_023987|LXL04_023987|OH1004|PROTEIN

MPEHVGDHSTSNPTGDNISTGGYVPHKELFGYSSPRSPLTTLSPESDSMGLSIDSPGGVDTSIEQLYNNVCEMQSSDQSPSRFSYLSYGQESRIDSELRFLAGGDFAKPDGGAAKDPVVIIDEKEFKETSNDSNPNQIIPGSEPSSTPKSRLPFRKKIPSKINPKKQEKISPNEDPAYLGTYLLKQARDLLSTGDNPKRAFKLAERALKSFESIQSEKPNLEVVMCLHIVAALNCSSGRYADAIPLLERSIEIPNMDQGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023987`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023987

Location Chr05:76992925-76995019 (-)

Description Similar to KLCR2: Protein KINESIN LIGHT CHAIN-RELATED 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27960`	Protein KINESIN LIGHT CHAIN-RELATED 2.	No verified direct reference in this release
`At1g27500`	Protein KINESIN LIGHT CHAIN-RELATED 3.	No verified direct reference in this release
`At4g10840`	Protein KINESIN LIGHT CHAIN-RELATED 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007368 determination of left/right symmetry Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045494 photoreceptor cell maintenance Biological Process

GO:0060271 cilium assembly Biological Process

GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry Biological Process

GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process

GO:2000095 regulation of Wnt signaling pathway, planar cell polarity pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G27500

ath:AT3G27960

ath:AT4G10840

hsa:27031

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.474

Rank 1 · LXL04_023987 · OH-1004

Nucleus0.280

Rank 2 · LXL04_023987 · OH-1004

Cell membrane0.167

Rank 3 · LXL04_023987 · OH-1004

Golgi apparatus0.094

Rank 4 · LXL04_023987 · OH-1004

Plastid0.090

Rank 5 · LXL04_023987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25063.1ARM_TT21_C307-374 aa

PF13424.13TPR_12316-370 aa

PF17874.8TPR_MalT316-458 aa

PF24885.2TPR_NPHP3378-508 aa

PF13424.13TPR_12386-459 aa

PF00515.35TPR_1393-416 aa

PF13414.13TPR_11394-416 aa

PF13424.13TPR_12428-502 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023987	`PF25063.1`	ARM_TT21_C	307	374	2.2e-06	28.4
LXL04_023987	`PF13424.13`	TPR_12	316	370	5.1e-47	158.7
LXL04_023987	`PF17874.8`	TPR_MalT	316	458	6.9e-09	36.1
LXL04_023987	`PF24885.2`	TPR_NPHP3	378	508	3.8e-20	73.0
LXL04_023987	`PF13424.13`	TPR_12	386	459	5.1e-47	158.7
LXL04_023987	`PF00515.35`	TPR_1	393	416	2.5e-26	91.1
LXL04_023987	`PF13414.13`	TPR_11	394	416	3.2e-11	43.5
LXL04_023987	`PF13424.13`	TPR_12	428	502	5.1e-47	158.7
LXL04_023987	`PF13424.13`	TPR_12	517	586	5.1e-47	158.7
LXL04_023987	`PF13424.13`	TPR_12	556	626	5.1e-47	158.7
LXL04_023987	`PF13374.13`	TPR_10	596	637	8.2e-32	109.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LII8`	Arabidopsis thaliana	Protein KINESIN LIGHT CHAIN-RELATED 2	61.787%	Swiss-Prot	strong database homology
`F4HSX9`	Arabidopsis thaliana	Protein KINESIN LIGHT CHAIN-RELATED 3	56.082%	Swiss-Prot	strong database homology
`O81629`	Arabidopsis thaliana	Protein KINESIN LIGHT CHAIN-RELATED 1	54.404%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card