LXL04_023960 | RubberDandelionOmics

Gene overview

LXL04_023960

Reference: OH-1004 Chr: Chr05 Coordinates: 75712514-75714645 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

814 bp · LXL04_023960|LXL04_023960|OH1004|cDNA

attaaaaaaaaatatttttatgaGCAGATGTTGTATGCGAAGTCCTGCTAAAAAAACAAGAAATGGTCAGAATTATTACGAGTTGCTTGGCGTATCTGTGGACTCCAATTCTAAAGAAATAAAAGAATCCTACAGAAAACTACAAAAGAAATACCATCCAGATATTGCAGGCCAAAAGGGTCATGAACATACGCTTCTACTAAACGAAGCGTATCATGTGCTAATGAAAGACAATTTAAGAAAAGATTATGATGCTTCTA...

CDS

Download CDS FASTA

795 bp · LXL04_023960|LXL04_023960|OH1004|CDS

ATGAGCAGATGTTGTATGCGAAGTCCTGCTAAAAAAACAAGAAATGGTCAGAATTATTACGAGTTGCTTGGCGTATCTGTGGACTCCAATTCTAAAGAAATAAAAGAATCCTACAGAAAACTACAAAAGAAATACCATCCAGATATTGCAGGCCAAAAGGGTCATGAACATACGCTTCTACTAAACGAAGCGTATCATGTGCTAATGAAAGACAATTTAAGAAAAGATTATGATGCTTCTATTGGCCATGTAAGGGTCGG...

Protein

Download Protein FASTA

264 aa · LXL04_023960|LXL04_023960|OH1004|PROTEIN

MSRCCMRSPAKKTRNGQNYYELLGVSVDSNSKEIKESYRKLQKKYHPDIAGQKGHEHTLLLNEAYHVLMKDNLRKDYDASIGHVRVGFGGDALDMGHSSWNGPFRPHALFVDEKACIGCRECVHNARNTFIMDEIVGCARVNVQFGDDDTSIEVAVESCPMDCIHWVEKEELAILEYFNIPRPKQGHGVFNQGWERPQNVFMAAKTFQKQQQQAQSESQSQHKTARCDVEQETEAQAKARESASFKLKMERFSGLWEWVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023960`
TK1151 ID	TkAUNG018680
OH-1004 ID	LXL04_023960
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	97.000
Protein coverage (%)	TK1151 89.492 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023960

Location Chr05:75712514-75714645 (-)

Description Similar to DJC76: Chaperone protein dnaJ C76, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23240`	May function together with HSC70 chaperone to assist protein folding and prevent protein aggregation during salt stress in the chloroplast (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023960 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031072 heat shock protein binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G23240

sab:SAB1451c

sam:MW1531

sax:USA300HOU_1580

sca:SCA_1201

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.728

Rank 1 · LXL04_023960 · OH-1004

Plastid0.208

Rank 2 · LXL04_023960 · OH-1004

Nucleus0.063

Rank 3 · LXL04_023960 · OH-1004

Cytoplasm0.062

Rank 4 · LXL04_023960 · OH-1004

Cell membrane0.016

Rank 5 · LXL04_023960 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ18-78 aa

PF13370.12Fer4_13111-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023960	`PF00226.37`	DnaJ	18	78	3.3e-16	59.9
LXL04_023960	`PF13370.12`	Fer4_13	111	166	3.7e-10	41.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMX6`	Arabidopsis thaliana	Chaperone protein dnaJ C76, chloroplastic	40.580%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card