LXL04_023853 | RubberDandelionOmics

Gene overview

LXL04_023853

Reference: OH-1004 Chr: Chr05 Coordinates: 71255820-71259660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1863 bp · LXL04_023853|LXL04_023853|OH1004|cDNA

ATGCCGCCAACTTATTTCCCTCTCCGATGGGAGAGCACCGGAGACCAGTGGTGGTACGCTTCCCCAATCGACTGGGCCGCCGCGAACGGCCACTACGATTTAGTCCGTGAGCTTCTCCGCCTAGACAGCAACCATCTAATCAAACTTTCATCTCTCCGGCGAATCCGCCGCCTCGAGGTAGTCTGGGACGACGAAGAACAGTTCGACGACGTTGCCAAAAACCGTTCTTTTGTCGCCCAAAAACTGTTACACGAAGGCGA...

CDS

Download CDS FASTA

1863 bp · LXL04_023853|LXL04_023853|OH1004|CDS

ATGCCGCCAACTTATTTCCCTCTCCGATGGGAGAGCACCGGAGACCAGTGGTGGTACGCTTCCCCAATCGACTGGGCCGCCGCGAACGGCCACTACGATTTAGTCCGTGAGCTTCTCCGCCTAGACAGCAACCATCTAATCAAACTTTCATCTCTCCGGCGAATCCGCCGCCTCGAGGTAGTCTGGGACGACGAAGAACAGTTCGACGACGTTGCCAAAAACCGTTCTTTTGTCGCCCAAAAACTGTTACACGAAGGCGA...

Protein

Download Protein FASTA

620 aa · LXL04_023853|LXL04_023853|OH1004|PROTEIN

MPPTYFPLRWESTGDQWWYASPIDWAAANGHYDLVRELLRLDSNHLIKLSSLRRIRRLEVVWDDEEQFDDVAKNRSFVAQKLLHEGDAKRGKNSLIGSGYGGWLLYTAASAGDFPFVQELLHKDPLLVFGEGEYGVTDILYAAARGKNAEVFRLIYDFAMFPRFMGGNGGGVPAAYKEEMKNRAVHAVARGGNLDILKELLGDSDDNKVLSYRDMQGSTALHTAAGRGQIEVVKYLVSTYEMINSSDKQGNTPLHIAASR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023853`
TK1151 ID	TkA06G206500
OH-1004 ID	LXL04_023853
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023853

Location Chr05:71255820-71259660 (-)

Description Similar to anks1b: Ankyrin repeat and sterile alpha motif domain-containing protein 1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023853 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0048013 ephrin receptor signaling pathway Biological Process

GO:1900383 regulation of synaptic plasticity by receptor localization to synapse Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0046875 ephrin receptor binding Molecular Function

KEGG gene cross-reference

ath:AT5G02620

dre:565408

hsa:348094

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.619

Rank 1 · LXL04_023853 · OH-1004

Nucleus0.262

Rank 2 · LXL04_023853 · OH-1004

Cytoplasm0.200

Rank 3 · LXL04_023853 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_023853 · OH-1004

Plastid0.036

Rank 5 · LXL04_023853 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24521.3Ank_KRIT1180-261 aa

PF12796.14Ank_2186-272 aa

PF13637.13Ank_4186-237 aa

PF13637.13Ank_4243-270 aa

PF13857.13Ank_5243-289 aa

PF12796.14Ank_2244-293 aa

PF00023.37Ank249-282 aa

PF13606.13Ank_3250-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023853	`PF24521.3`	Ank_KRIT1	180	261	7.5e-10	39.4
LXL04_023853	`PF12796.14`	Ank_2	186	272	2.2e-36	125.0
LXL04_023853	`PF13637.13`	Ank_4	186	237	6.9e-27	93.6
LXL04_023853	`PF13637.13`	Ank_4	243	270	6.9e-27	93.6
LXL04_023853	`PF13857.13`	Ank_5	243	289	1.9e-25	89.4
LXL04_023853	`PF12796.14`	Ank_2	244	293	2.2e-36	125.0
LXL04_023853	`PF00023.37`	Ank	249	282	9.7e-29	98.5
LXL04_023853	`PF13606.13`	Ank_3	250	271	4.8e-22	76.1
LXL04_023853	`PF12796.14`	Ank_2	310	372	2.2e-36	125.0
LXL04_023853	`PF13857.13`	Ank_5	325	373	1.9e-25	89.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWW5`	Arabidopsis thaliana	Ankyrin repeat-containing protein At5g02620	28.440%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card