LXL04_023828 | RubberDandelionOmics

Gene overview

LXL04_023828

Reference: OH-1004 Chr: Chr05 Coordinates: 70209575-70210639 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

618 bp · LXL04_023828|LXL04_023828|OH1004|cDNA

ATGGATTCGCAAAACGACTTCGATCGGCTTCTCTTCTTTGAGCATGCTCGCCGGAGTGCGGAAGTGACTTATGCGAAAAATCCTCTCGATACCGAGAACCTAACCAGATGGGGAGGGGCGTTGCTTGAACTGTCGACCTTCCAGAGTGTTCAGGAATCAAAATCTATGATTAAAGATGCTATATCAAAATTAGACGAAGCATTATCGATTGATCCAAGGAAACATGACGCGTTGTGGTGTATGGGCAATGCACAAACTTC...

CDS

Download CDS FASTA

618 bp · LXL04_023828|LXL04_023828|OH1004|CDS

ATGGATTCGCAAAACGACTTCGATCGGCTTCTCTTCTTTGAGCATGCTCGCCGGAGTGCGGAAGTGACTTATGCGAAAAATCCTCTCGATACCGAGAACCTAACCAGATGGGGAGGGGCGTTGCTTGAACTGTCGACCTTCCAGAGTGTTCAGGAATCAAAATCTATGATTAAAGATGCTATATCAAAATTAGACGAAGCATTATCGATTGATCCAAGGAAACATGACGCGTTGTGGTGTATGGGCAATGCACAAACTTC...

Protein

Download Protein FASTA

205 aa · LXL04_023828|LXL04_023828|OH1004|PROTEIN

MDSQNDFDRLLFFEHARRSAEVTYAKNPLDTENLTRWGGALLELSTFQSVQESKSMIKDAISKLDEALSIDPRKHDALWCMGNAQTSYAFLTPDKSEAKGYFDSAYTYFQQAVEEDPGNELYRKSFEVSTKAPELHAEVHSQSLSQQAMGFGSGGGPSSSSSVRGPKAQKNSDLKYDIFGWVILAVTVVAWVGFAKTNVPSPPSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023828`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023828

Location Chr05:70209575-70210639 (-)

Description Similar to TOM20: Mitochondrial import receptor subunit TOM20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27080`	Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins.	No verified direct reference in this release
`At1g27390`	Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins.	No verified direct reference in this release
`At5g40930`	Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WYG9`	Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023828 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0015031 protein transport Biological Process

GO:0045040 protein insertion into mitochondrial outer membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005742 mitochondrial outer membrane translocase complex Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G27390

ath:AT3G27080

ath:AT5G40930

sot:102603648

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.372

Rank 1 · LXL04_023828 · OH-1004

Plastid0.222

Rank 2 · LXL04_023828 · OH-1004

Cytoplasm0.151

Rank 3 · LXL04_023828 · OH-1004

Endoplasmic reticulum0.119

Rank 4 · LXL04_023828 · OH-1004

Peroxisome0.108

Rank 5 · LXL04_023828 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06552.19TOM20_plant7-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023828	`PF06552.19`	TOM20_plant	7	196	4.4e-90	301.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82874`	Arabidopsis thaliana	Mitochondrial import receptor subunit TOM20-3	56.585%	Swiss-Prot	strong database homology
`P82873`	Arabidopsis thaliana	Mitochondrial import receptor subunit TOM20-2	54.106%	Swiss-Prot	strong database homology
`P82805`	Arabidopsis thaliana	Mitochondrial import receptor subunit TOM20-4	55.500%	Swiss-Prot	strong database homology
`A2WYG9`	Oryza sativa subsp. indica	Probable mitochondrial import receptor subunit TOM20	50.244%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card