LXL04_023615 | RubberDandelionOmics

Gene overview

LXL04_023615

Reference: OH-1004 Chr: Chr05 Coordinates: 56115059-56117504 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · LXL04_023615|LXL04_023615|OH1004|cDNA

ATGGCTTCCGTGGTGAAGAACGTTCTGAAGAGCATCAGAGAGAGGGGTCTTGTAAACTTCGCTAGAGAGCTTCGTGAAGAAGGATTTCTGTTCGTTCTTTTCCCTTCTACCTATCTGAATTGCCTAACTGATGGAAATCTTTTGCAAACGAAGATTCACAACATTGGTGCGACTTTAGTGGGTGTAGACAAAGTTGGGAATAAATACTACGAGAAGCTTGGAGAGACCCAATACGGAAGGCACAGGTGGGTGGAATACGC...

CDS

Download CDS FASTA

504 bp · LXL04_023615|LXL04_023615|OH1004|CDS

ATGGCTTCCGTGGTGAAGAACGTTCTGAAGAGCATCAGAGAGAGGGGTCTTGTAAACTTCGCTAGAGAGCTTCGTGAAGAAGGATTTCTGTTCGTTCTTTTCCCTTCTACCTATCTGAATTGCCTAACTGATGGAAATCTTTTGCAAACGAAGATTCACAACATTGGTGCGACTTTAGTGGGTGTAGACAAAGTTGGGAATAAATACTACGAGAAGCTTGGAGAGACCCAATACGGAAGGCACAGGTGGGTGGAATACGC...

Protein

Download Protein FASTA

167 aa · LXL04_023615|LXL04_023615|OH1004|PROTEIN

MASVVKNVLKSIRERGLVNFARELREEGFLFVLFPSTYLNCLTDGNLLQTKIHNIGATLVGVDKVGNKYYEKLGETQYGRHRWVEYASKNRYNASQVPPEWHGWLHFITDHTGDELLMLKPKRYGLDHKENFSGEGDEFIYHSKGHTLNPGQRDWTRYQSWQPTKTQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023615`
TK1151 ID	TkA06G284510
OH-1004 ID	LXL04_023615
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023615

Location Chr05:56115059-56117504 (+)

Description Similar to At3g03100: Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03100`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023615 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0042775 mitochondrial ATP synthesis coupled electron transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G03100

cel:CELE_Y94H6A.8

ddi:DDB_G0285783

ggo:101148753

ppyg:129010442

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.919

Rank 1 · LXL04_023615 · OH-1004

Cytoplasm0.061

Rank 2 · LXL04_023615 · OH-1004

Nucleus0.041

Rank 3 · LXL04_023615 · OH-1004

Cell membrane0.026

Rank 4 · LXL04_023615 · OH-1004

Endoplasmic reticulum0.024

Rank 5 · LXL04_023615 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05071.22NDUFA1258-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023615	`PF05071.22`	NDUFA12	58	163	1.2e-25	90.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9M9`	Arabidopsis thaliana	Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12	78.182%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card