Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1068 bp · LXL04_023556|LXL04_023556|OH1004|cDNA
GAAGGTTTTCAAACCCCCACGTCCTGCTCTTTCCGGATCTAAACTACTTCATCATTCTCCATTTCCCTCAAACTTCCCCAACTCCCTCTTCTTCGTCTCCTCCAGTTCCAAGTTTGCAGCGATCCCACAGCTTCAATTTTGCTTGAGAACGCCAGTCTCTCGCTCTTCGTCTTTGGATTCTTCCCCATTAAATCGGCTCTCCCGGTGTCAGTGGACCAGAGAGTTTCCGGCCTCCCTCACGCTATTTGGTTGAGGATCAA...
624 bp · LXL04_023556|LXL04_023556|OH1004|CDS
ATGAAGGTGTTCGTTTGGCCAAAGACCAAAGCATATATTTCTATGTTGTACCTCATAAAACTTAAAAACTTTAATATATTTTTAAGGGGGGAGCCTGTAGAGCAGTTCAATATAGCAGATGAATTCAAATGTAGGGAAGTAGTCACATATAGGCCACAAGTTTCTTCAATGAAAGAGGCGATTGTGGAGACAACCCTTGGATTTATTAAAGCAGCACCTGCCCTTCCAATTACCGGATTCAACATATACCATAAAAATCA...
Protein
Download Protein FASTA207 aa · LXL04_023556|LXL04_023556|OH1004|PROTEIN
MKVFVWPKTKAYISMLYLIKLKNFNIFLRGEPVEQFNIADEFKCREVVTYRPQVSSMKEAIVETTLGFIKAAPALPITGFNIYHKNHVIRVFLCEYIFLTTRVSLDVLFHFNTQALLEDNIVGQLFRIGWKMVMFGDETWLKLFPGLFTQHDRISSFFVKDTVKVDHNVSRHLSYELFKSDWNLPILHYLGLVHVGHLGGRTRYYLL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023556 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023556 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:50281314-50285173 (-) | |||||||||
| Description | Similar to PIGG: GPI ethanolamine phosphate transferase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002230 positive regulation of defense response to virus by host Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0006506 GPI anchor biosynthetic process Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0034052 positive regulation of plant-type hypersensitive response Biological Process GO:0051607 defense response to virus Biological Process GO:0098542 defense response to other organism Biological Process GO:1900426 positive regulation of defense response to bacterium Biological Process GO:1901672 positive regulation of systemic acquired resistance Biological Process | |||||||||
| KEGG gene cross-reference | afm:AFUA_6G05260 ath:AT4G36280 ath:AT4G36290 hsa:54872 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17942.9Morc6_S510-93 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_023556 | PF17942.9 | Morc6_S5 | 10 | 93 | 6.4e-25 | 88.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.