LXL04_023547 | RubberDandelionOmics

Gene overview

LXL04_023547

Reference: OH-1004 Chr: Chr05 Coordinates: 49397877-49399775 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1180 bp · LXL04_023547|LXL04_023547|OH1004|cDNA

TCAATTGCAACCTCCGCGAACCCCTTCCCTCAGCCTCCTCTGCTGCCGCCTCCGCCTGCCCTTTCCGCCCTTCGCCCAAAACCCTACTCGACAGACTCAATATCGTTGATCCTGTCAACAGGAGCAAGTAGACTCCCAGATTTGAAGATCATGGCTAAGAAAAAGCCTATAGAGGGAGTGAGTGATCAGATGAATGCGATTGCGTCTCAAAATCTCGATCACGCACCTGCTCGCCGGAGAGTTCGATTGGCTTTCACTCA...

CDS

Download CDS FASTA

987 bp · LXL04_023547|LXL04_023547|OH1004|CDS

ATGCGATTGCGTCTCAAAATCTCGATCACGCACCTGCTCGCCGGAGAGTTCGATTGGCTTTCACTCAAGTTCAGGAACAGCTTGATCACGTTTTGTTTTAGTTTTCTGGTTGCTCTGATTAATCGACAGATGGCTCCTACAGGAATCAGGACTGAAGAGTGGTTTGAAATGAACTCAAAGGGTGAGGAAATATTCTGTAAAAGCTGGTTACCAAGGCCTGGAGTCCGAATAAAAGCGGCTGTGTGTTTTGTCCATGGCTA...

Protein

Download Protein FASTA

328 aa · LXL04_023547|LXL04_023547|OH1004|PROTEIN

MRLRLKISITHLLAGEFDWLSLKFRNSLITFCFSFLVALINRQMAPTGIRTEEWFEMNSKGEEIFCKSWLPRPGVRIKAAVCFVHGYGDTCTFFFEGIAKRIAAAGYGVYAIDHPGFGLSEGLHGYIPNFSDLVGNVIEQYTKIKGRPEVRGMPRFLLGQSMGGAVALKVHLKEQREWDGVVLVATMCKISEEMKPPEPLQKVLNILSRLMPKAKLVPQKDLAELVFRDPQKRKLADYNVISYSDQTRLKTAVELLNATN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023547`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023547

Location Chr05:49397877-49399775 (+)

Description Similar to CSE: Caffeoylshikimate esterase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52760`	Esterase involved in the biosynthesis of lignin.	Acyl-CoA-binding protein 2 binds lysophospholipase 2 and lysoPC to promote tolerance to cadmium-induced oxidative stress in transgenic Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04209.x A bifunctional enzyme that has both monoacylglycerol acyltransferase and acyl hydrolase activities.2012 · DOI: 10.1104/pp.112.202135

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023547 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0019369 arachidonate metabolic process Biological Process

GO:0019433 triglyceride catabolic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045471 response to ethanol Biological Process

GO:0045907 positive regulation of vasoconstriction Biological Process

KEGG gene cross-reference

ath:AT1G52760

hsa:11343

mmu:23945

msg:MSMEI_0213

msm:MSMEG_0220

rno:29254

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.381

Rank 1 · LXL04_023547 · OH-1004

Cytoplasm0.264

Rank 2 · LXL04_023547 · OH-1004

Cell membrane0.138

Rank 3 · LXL04_023547 · OH-1004

Mitochondrion0.138

Rank 4 · LXL04_023547 · OH-1004

Nucleus0.128

Rank 5 · LXL04_023547 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146.16Hydrolase_477-317 aa

PF00561.27Abhydrolase_180-315 aa

PF12697.14Abhydrolase_683-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023547	`PF12146.16`	Hydrolase_4	77	317	8.7e-65	219.1
LXL04_023547	`PF00561.27`	Abhydrolase_1	80	315	1.1e-15	58.8
LXL04_023547	`PF12697.14`	Abhydrolase_6	83	318	3.4e-11	44.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C942`	Arabidopsis thaliana	Caffeoylshikimate esterase	32.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card