LXL04_023521 | RubberDandelionOmics

Gene overview

LXL04_023521

Reference: OH-1004 Chr: Chr05 Coordinates: 47550347-47550712 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · LXL04_023521|LXL04_023521|OH1004|cDNA

ATGAAGATACCTTGTTGCACGGTTTGTCAGACAAGGTACAACGAAGAATATAGGTGTCCGTTGTTACTCGAGTGCGGCCATGGATTCTGTAAAGAGTGTCTCTCTCGTATGTTTTCATCAGCGTCATCAGACACTACTCTTTCCATTCCACGATGTCGCCAAGTCTCCGTTGTCGGTAACTCTTCTGCTTCCAATAGTGATTTTACCGACGTAGACGAAGACGATGAGGACGATGggttggtggtggtggtggtggtgga...

CDS

Download CDS FASTA

366 bp · LXL04_023521|LXL04_023521|OH1004|CDS

ATGAAGATACCTTGTTGCACGGTTTGTCAGACAAGGTACAACGAAGAATATAGGTGTCCGTTGTTACTCGAGTGCGGCCATGGATTCTGTAAAGAGTGTCTCTCTCGTATGTTTTCATCAGCGTCATCAGACACTACTCTTTCCATTCCACGATGTCGCCAAGTCTCCGTTGTCGGTAACTCTTCTGCTTCCAATAGTGATTTTACCGACGTAGACGAAGACGATGAGGACGATGGGTTGGTGGTGGTGGTGGTGGTGGA...

Protein

Download Protein FASTA

121 aa · LXL04_023521|LXL04_023521|OH1004|PROTEIN

MKIPCCTVCQTRYNEEYRCPLLLECGHGFCKECLSRMFSSASSDTTLSIPRCRQVSVVGNSSASNSDFTDVDEDDEDDGLVVVVVVDRNRRSCGLNTSSSNGLIELGSHQDLRMVRRSCDG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023521`
TK1151 ID	TkA06G316920
OH-1004 ID	LXL04_023521
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 57.937 / OH-1004 60.331 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023521

Location Chr05:47550347-47550712 (-)

Description Similar to KEG: E3 ubiquitin-protein ligase KEG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13530`	Mediates E2-dependent protein ubiquitination.	Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.2008 · DOI: 10.1104/pp.108.127605

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006952 defense response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016197 endosomal transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032940 secretion by cell Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0048589 developmental growth Biological Process

GO:0051865 protein autoubiquitination Biological Process

KEGG gene cross-reference

ath:AT5G13530

hsa:138065

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.538

Rank 1 · LXL04_023521 · OH-1004

Cytoplasm0.459

Rank 2 · LXL04_023521 · OH-1004

Cell membrane0.082

Rank 3 · LXL04_023521 · OH-1004

Lysosome / Vacuole0.052

Rank 4 · LXL04_023521 · OH-1004

Mitochondrion0.041

Rank 5 · LXL04_023521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_25-42 aa

PF13445.13zf-RING_UBOX6-41 aa

PF00097.32zf-C3HC46-39 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023521	`PF13639.13`	zf-RING_2	5	42	4e-06	27.7
LXL04_023521	`PF13445.13`	zf-RING_UBOX	6	41	2.7e-07	31.2
LXL04_023521	`PF00097.32`	zf-C3HC4	6	39	5.9e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY48`	Arabidopsis thaliana	E3 ubiquitin-protein ligase KEG	45.324%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card