LXL04_023350 | RubberDandelionOmics

Gene overview

LXL04_023350

Reference: OH-1004 Chr: Chr05 Coordinates: 34345130-34346958 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1497 bp · LXL04_023350|LXL04_023350|OH1004|cDNA

ATGTTGAAGCAGCTTCTCGCCAAGCTTCCCAAGAGATCACCCAAGTCTTTTGAATCTTTCGAAGATCCTTCAAGTAGTCCCAACAATGGCGGATTTCAAAGAACACAAAGCTTAAACAGCGCATCACCAAAACCCAACGCACCTAAAAGAACATCATCGGCGGTTTTCCCGTCAAGCGTCATCGCCGGAATCGAACCTCTTTTACCCTTCAAAGATGCTCCCGCTTCAGAAAAAATGTCGCTTTTCATCAGTAAGTTAAG...

CDS

Download CDS FASTA

1497 bp · LXL04_023350|LXL04_023350|OH1004|CDS

ATGTTGAAGCAGCTTCTCGCCAAGCTTCCCAAGAGATCACCCAAGTCTTTTGAATCTTTCGAAGATCCTTCAAGTAGTCCCAACAATGGCGGATTTCAAAGAACACAAAGCTTAAACAGCGCATCACCAAAACCCAACGCACCTAAAAGAACATCATCGGCGGTTTTCCCGTCAAGCGTCATCGCCGGAATCGAACCTCTTTTACCCTTCAAAGATGCTCCCGCTTCAGAAAAAATGTCGCTTTTCATCAGTAAGTTAAG...

Protein

Download Protein FASTA

498 aa · LXL04_023350|LXL04_023350|OH1004|PROTEIN

MLKQLLAKLPKRSPKSFESFEDPSSSPNNGGFQRTQSLNSASPKPNAPKRTSSAVFPSSVIAGIEPLLPFKDAPASEKMSLFISKLSLCCMVFDFSDPTKNTAEKDLKRLTLIELLDFIASGPPKFSEPAILALCKMCSINLFRVFPPNYRASRSSNGGENDDDEPSFDPAWPHLQLVYDILLKFVNSPSVEPKIAKKYINHSFILRILDLFESEDPRERDCLKAIMHRIYGKFMVHRPFIRKSISNVFYRFVFETDKHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023350`
TK1151 ID	TkA06G357760
OH-1004 ID	LXL04_023350
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023350

Location Chr05:34345130-34346958 (+)

Description Similar to B'KAPPA: Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25510`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`At4g15415`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).	Regulatory subunit B'gamma of protein phosphatase 2A prevents unnecessary defense reactions under low light in Arabidopsis.2011 · DOI: 10.1104/pp.111.178442
`At3g21650`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).	No verified direct reference in this release
`At1g13460`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0555100`	B regulatory subunit of phosphatase 2A (PP2A) involved in salt stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023350 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006555 methionine metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0009908 flower development Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0032000 positive regulation of fatty acid beta-oxidation Biological Process

GO:0033353 S-adenosylmethionine cycle Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G13460

ath:AT3G21650

ath:AT4G15415

ath:AT5G25510

dosa:Os05g0555100

osa:4339558

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · LXL04_023350 · OH-1004

Nucleus0.418

Rank 2 · LXL04_023350 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_023350 · OH-1004

Golgi apparatus0.067

Rank 4 · LXL04_023350 · OH-1004

Lysosome / Vacuole0.061

Rank 5 · LXL04_023350 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01603.27B5669-478 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023350	`PF01603.27`	B56	69	478	6.4e-181	602.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YV6`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform	68.750%	Swiss-Prot	strong database homology
`Q8RW96`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform	53.922%	Swiss-Prot	strong database homology
`Q9LVE2`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' zeta isoform	52.919%	Swiss-Prot	strong database homology
`Q8LF36`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' theta isoform	57.359%	Swiss-Prot	strong database homology
`Q6I621`	Oryza sativa subsp. japonica	Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform	62.178%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card