LXL04_023246 | RubberDandelionOmics

Gene overview

LXL04_023246

Reference: OH-1004 Chr: Chr05 Coordinates: 28448676-28454536 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1551 bp · LXL04_023246|LXL04_023246|OH1004|cDNA

ATGAAGAACATCGTGAAATCCGGCGAAGAAGATGCAGATGCTTCTTCCTCCTTCAGTCGTTTACCAGACGAACTTATCCTCCAAATTATAAACAGATTGATTGATTTGAAAACTCTATGCTTTTGCTATCTGGTTTCCAAACGTTTCTCCTCCATTGTACTTCAAGTCGATGCCGTCTCCTTCACTGCTCCGCTGTTGAACTCTCCCACCTCCGATGATAACACATTCGGCGATGTCGACGGCGGAGGGTTGCCCAGAAA...

CDS

Download CDS FASTA

1551 bp · LXL04_023246|LXL04_023246|OH1004|CDS

ATGAAGAACATCGTGAAATCCGGCGAAGAAGATGCAGATGCTTCTTCCTCCTTCAGTCGTTTACCAGACGAACTTATCCTCCAAATTATAAACAGATTGATTGATTTGAAAACTCTATGCTTTTGCTATCTGGTTTCCAAACGTTTCTCCTCCATTGTACTTCAAGTCGATGCCGTCTCCTTCACTGCTCCGCTGTTGAACTCTCCCACCTCCGATGATAACACATTCGGCGATGTCGACGGCGGAGGGTTGCCCAGAAA...

Protein

Download Protein FASTA

516 aa · LXL04_023246|LXL04_023246|OH1004|PROTEIN

MKNIVKSGEEDADASSSFSRLPDELILQIINRLIDLKTLCFCYLVSKRFSSIVLQVDAVSFTAPLLNSPTSDDNTFGDVDGGGLPRKFFRLLINGVVFKPLSLLRRMIVTQSKPLPPIISSFYGQSFRSAVTFLSKFKGVKSLTVELPSSSHKGIDSSCLFKWKVRFGSRIESFFFLSPDSISETDEFHVNEIGDEEDINISNDLFRQKVHNAFQCLKDVILRHRMLLYIAKDLPMLEEVYITDSGRRGRLSISGAKLAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023246`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023246

Location Chr05:28448676-28454536 (+)

Description Similar to At1g22220: F-box protein At1g22220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22220`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g46170`	F-box protein At5g46170.	No verified direct reference in this release
`At1g78100`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	AUXIN UP-REGULATED F-BOX PROTEIN1 regulates the cross talk between auxin transport and cytokinin signaling during plant root growth.2011 · DOI: 10.1104/pp.111.179812
`At1g30200`	F-box protein At1g30200.	No verified direct reference in this release
`At4g18380`	F-box protein At4g18380.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023246 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0010541 acropetal auxin transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G22220

ath:AT1G30200

ath:AT1G78100

ath:AT4G18380

ath:AT5G46170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.616

Rank 1 · LXL04_023246 · OH-1004

Cytoplasm0.303

Rank 2 · LXL04_023246 · OH-1004

Cell membrane0.129

Rank 3 · LXL04_023246 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_023246 · OH-1004

Mitochondrion0.037

Rank 5 · LXL04_023246 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937.13F-box-like18-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023246	`PF12937.13`	F-box-like	18	53	3.9e-10	40.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM18`	Arabidopsis thaliana	F-box protein AUF2	26.590%	Swiss-Prot	weak database homology
`Q9FNK5`	Arabidopsis thaliana	F-box protein At5g46170	24.850%	Swiss-Prot	weak database homology
`Q9C9S2`	Arabidopsis thaliana	F-box protein AUF1	25.143%	Swiss-Prot	weak database homology
`Q9C534`	Arabidopsis thaliana	F-box protein At1g30200	26.214%	Swiss-Prot	weak database homology
`O49508`	Arabidopsis thaliana	F-box protein At4g18380	26.686%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card