LXL04_023104 | RubberDandelionOmics

Gene overview

LXL04_023104

Reference: OH-1004 Chr: Chr05 Coordinates: 23387162-23394547 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2898 bp · LXL04_023104|LXL04_023104|OH1004|cDNA

ATGAGAGGAAGAACAGATGGATCTCAGAAGAAACGTTTACTCACCACTTTCTTTCTCGTGGCAGTTTTTCTTCTTTTCCTGTACTTGTACTTTGGCTCCCAGAGTCAAGGTGAGTCAGCCCTAGAATATGGCAGCAGGTCTCTTCGCAAACTCGGATCTTCCTACTTAGGTGGCGATGATGAATCTGATCTTGCAATCAAGCAAGATGATTTTAAATTTGGGTTGGATGATGAAGATGGTATTGTCCCAAAGAGTTTTCC...

CDS

Download CDS FASTA

2898 bp · LXL04_023104|LXL04_023104|OH1004|CDS

ATGAGAGGAAGAACAGATGGATCTCAGAAGAAACGTTTACTCACCACTTTCTTTCTCGTGGCAGTTTTTCTTCTTTTCCTGTACTTGTACTTTGGCTCCCAGAGTCAAGGTGAGTCAGCCCTAGAATATGGCAGCAGGTCTCTTCGCAAACTCGGATCTTCCTACTTAGGTGGCGATGATGAATCTGATCTTGCAATCAAGCAAGATGATTTTAAATTTGGGTTGGATGATGAAGATGGTATTGTCCCAAAGAGTTTTCC...

Protein

Download Protein FASTA

965 aa · LXL04_023104|LXL04_023104|OH1004|PROTEIN

MRGRTDGSQKKRLLTTFFLVAVFLLFLYLYFGSQSQGESALEYGSRSLRKLGSSYLGGDDESDLAIKQDDFKFGLDDEDGIVPKSFPVCDDRYSELIPCLDRNLIYQMRLKLDLSLMEHYERHCPLPERRFNCLIPPPSGYKVPTKWPKSRDEVWKANIPHTHLAHEKSDQNWMVVKGEKIIFPGGGTHFHYGADKYIKSLANMLNFPKDNMNNEGNLRTVLDVGCGVASFGGYLLSSDILTMSLAPNDVHQNQIQFALE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023104`
TK1151 ID	TkA06G401880
OH-1004 ID	LXL04_023104
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 99.354 / OH-1004 63.731 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023104

Location Chr05:23387162-23394547 (+)

Description Similar to At1g04430: Probable methyltransferase PMT8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04430`	Probable methyltransferase PMT8.	No verified direct reference in this release
`At3g23300`	Probable methyltransferase PMT1.	No verified direct reference in this release
`At4g14360`	Probable methyltransferase PMT3.	No verified direct reference in this release
`At5g14430`	Probable methyltransferase PMT9.	No verified direct reference in this release
`At5g06050`	Probable methyltransferase PMT12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023104 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0008168 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04430

ath:AT3G23300

ath:AT4G14360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.516

Rank 1 · LXL04_023104 · OH-1004

Endoplasmic reticulum0.177

Rank 2 · LXL04_023104 · OH-1004

Extracellular0.102

Rank 3 · LXL04_023104 · OH-1004

Lysosome / Vacuole0.101

Rank 4 · LXL04_023104 · OH-1004

Cytoplasm0.091

Rank 5 · LXL04_023104 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_2995-606 aa

PF08241.19Methyltransf_11222-316 aa

PF03141.23Methyltransf_29632-952 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023104	`PF03141.23`	Methyltransf_29	95	606		1094.3
LXL04_023104	`PF08241.19`	Methyltransf_11	222	316	4.2e-09	37.6
LXL04_023104	`PF03141.23`	Methyltransf_29	632	952		1094.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940J9`	Arabidopsis thaliana	Probable methyltransferase PMT8	77.814%	Swiss-Prot	moderate database homology
`Q8H118`	Arabidopsis thaliana	Probable methyltransferase PMT1	77.472%	Swiss-Prot	moderate database homology
`Q93YV7`	Arabidopsis thaliana	Probable methyltransferase PMT3	79.187%	Swiss-Prot	moderate database homology
`Q8VZV7`	Arabidopsis thaliana	Probable methyltransferase PMT9	62.153%	Swiss-Prot	moderate database homology
`Q9FG39`	Arabidopsis thaliana	Probable methyltransferase PMT12	45.489%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card