RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_023095
Reference: OH-1004 Chr: Chr05 Coordinates: 22982489-22985169 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1365 bp · LXL04_023095|LXL04_023095|OH1004|cDNA

ATGGGTTTACAGCAATCAAAGGACGAGCTATTGTATCAACAAGTCACTTATGGCAACTCTGAAGGCATTAAATCGCTTCGCAACGAAGGTGCTGGCCTTGAGTGGATGGATAAAGAAGGAAAGACTCCTCTCATATTGGCTTCCATGAGTCCACAGCTATATGACGTTGCAAAAACCCTAATAGAATTGGGTGCCAATGTGAACGCCTATCGTCCAGGTCGCCATGCTGGAACTCCTCTCCATCATGCTGCAAAAAGAGG...

CDS

Download CDS FASTA

1365 bp · LXL04_023095|LXL04_023095|OH1004|CDS

ATGGGTTTACAGCAATCAAAGGACGAGCTATTGTATCAACAAGTCACTTATGGCAACTCTGAAGGCATTAAATCGCTTCGCAACGAAGGTGCTGGCCTTGAGTGGATGGATAAAGAAGGAAAGACTCCTCTCATATTGGCTTCCATGAGTCCACAGCTATATGACGTTGCAAAAACCCTAATAGAATTGGGTGCCAATGTGAACGCCTATCGTCCAGGTCGCCATGCTGGAACTCCTCTCCATCATGCTGCAAAAAGAGG...

Protein

Download Protein FASTA

454 aa · LXL04_023095|LXL04_023095|OH1004|PROTEIN

MGLQQSKDELLYQQVTYGNSEGIKSLRNEGAGLEWMDKEGKTPLILASMSPQLYDVAKTLIELGANVNAYRPGRHAGTPLHHAAKRGLEQMVKLLLSHDANALVMNDDCQTALDVARLKGYSNVVRAIENHICLFSGWLQELYGPGFLELLAPQLLSRKVWVVILPCGARKLTKPFKLELAIYSGLQDAKPRSLLPLWKVNMDEPNFNQPDPTVILSSSNIPRRWRRRRCIMHSQIRQSRIKLAPVNENEKQQLQRFCNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_023095
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_023095
LocationChr05:22982489-22985169 (+)
DescriptionSimilar to XBAT35: Putative E3 ubiquitin-protein ligase XBAT35
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g23280 No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro. No verified direct reference in this release
At4g14365 No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro. No verified direct reference in this release
At4g35450 Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle.
An ankyrin repeat-containing protein plays a role in both disease resistance and antioxidation metabolism.2002 · DOI: 10.1046/j.0960-7412.2001.01205.x
AKR2A-mediated import of chloroplast outer membrane proteins is essential for chloroplast biogenesis.2008 · DOI: 10.1038/ncb1683
ANKYRIN REPEAT-CONTAINING PROTEIN 2A is an essential molecular chaperone for peroxisomal membrane-bound ASCORBATE PEROXIDASE3 in Arabidopsis.2010 · DOI: 10.1105/tpc.109.065979
At2g17390 Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0446100 Probable E3 ubiquitin-protein ligase XBOS34. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_023095 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006457 protein folding Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0043067 regulation of programmed cell death Biological Process
GO:0045036 protein targeting to chloroplast Biological Process
GO:0070417 cellular response to cold Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT3G23280
ath:AT4G14365
ath:AT4G35450
dosa:Os07g0446100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448
Rank 1 · LXL04_023095 · OH-1004
Nucleus0.240
Rank 2 · LXL04_023095 · OH-1004
Cell membrane0.220
Rank 3 · LXL04_023095 · OH-1004
Lysosome / Vacuole0.148
Rank 4 · LXL04_023095 · OH-1004
Golgi apparatus0.138
Rank 5 · LXL04_023095 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_29-69 aa
PF13857.13Ank_560-116 aa
PF12796.14Ank_278-128 aa
PF00023.37Ank78-105 aa
PF13637.13Ank_480-125 aa
PF13920.13zf-C3HC4_3400-448 aa
PF14447.13Prok-RING_4403-447 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_023095PF12796.14Ank_29694.3e-1556.8
LXL04_023095PF13857.13Ank_5601166.8e-0833.4
LXL04_023095PF12796.14Ank_2781284.3e-1556.8
LXL04_023095PF00023.37Ank781051.3e-1247.9
LXL04_023095PF13637.13Ank_4801251.6e-0835.3
LXL04_023095PF13920.13zf-C3HC4_34004486.3e-1349.0
LXL04_023095PF14447.13Prok-RING_44034471.8e-0628.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q4FE47Arabidopsis thalianaPutative E3 ubiquitin-protein ligase XBAT3554.812%Swiss-Protstrong database homology
Q9FPH0Arabidopsis thalianaPutative E3 ubiquitin-protein ligase XBAT3453.106%Swiss-Protmoderate database homology
Q9SAR5Arabidopsis thalianaAnkyrin repeat domain-containing protein 2A35.200%Swiss-Protweak database homology
Q29Q26Arabidopsis thalianaAnkyrin repeat domain-containing protein 2B33.600%Swiss-Protweak database homology
Q7XI08Oryza sativa subsp. japonicaProbable E3 ubiquitin-protein ligase XBOS3445.558%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser