LXL04_022947 | RubberDandelionOmics

Gene overview

LXL04_022947

Reference: OH-1004 Chr: Chr05 Coordinates: 14466278-14467342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · LXL04_022947|LXL04_022947|OH1004|cDNA

ATGAATGATTTGATGACAAAATCCTTCACTAGCTACGTAGATCTGAAGAAATCATCGATGAAGGACATAGATCTGGAAGCTGGTCCAGAGCACGATCTCCAGATGCACACCATACAGCAACCAGATCACAACCTCACCTCCTTCCTCCATGAAGCCGAGCTCGTGAAACAAGAAATGAACTCAATCCGCGAAACTCTAGCTCAACTGCAATCAGCGAATCAGGAATCCAAAACGCTTCACAATCCAGATGCGTTGAAGTC...

CDS

Download CDS FASTA

954 bp · LXL04_022947|LXL04_022947|OH1004|CDS

ATGAATGATTTGATGACAAAATCCTTCACTAGCTACGTAGATCTGAAGAAATCATCGATGAAGGACATAGATCTGGAAGCTGGTCCAGAGCACGATCTCCAGATGCACACCATACAGCAACCAGATCACAACCTCACCTCCTTCCTCCATGAAGCCGAGCTCGTGAAACAAGAAATGAACTCAATCCGCGAAACTCTAGCTCAACTGCAATCAGCGAATCAGGAATCCAAAACGCTTCACAATCCAGATGCGTTGAAGTC...

Protein

Download Protein FASTA

317 aa · LXL04_022947|LXL04_022947|OH1004|PROTEIN

MNDLMTKSFTSYVDLKKSSMKDIDLEAGPEHDLQMHTIQQPDHNLTSFLHEAELVKQEMNSIRETLAQLQSANQESKTLHNPDALKSIRRQINGDIVTVLKKAKTIKSRLEEMDRANAESRRLSGCKQGTPVDRTRTAVANGLRKKLKELMMDFQGLRQRMMTEYKETVGRRYFTVTGEQPNEEVIEKIISSGTDGQGGEEFLSRAIQEHGRGKVLETVVEIQDRHDAAKEIETSLLELHQVFLDMAVMVEAQGEKMDDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022947`
TK1151 ID	TkA06G425250
OH-1004 ID	LXL04_022947
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022947

Location Chr05:14466278-14467342 (+)

Description Similar to KN: Syntaxin-related protein KNOLLE

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08560`	Involved in cytokinesis.	No verified direct reference in this release
`At1g61290`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At1g11250`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At4g03330`	Vesicle trafficking protein that functions in the secretory pathway (Probable).	Syntaxin of plant proteins SYP123 and SYP132 mediate root hair tip growth in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pcu048

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0736500`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022947 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0048278 vesicle docking Biological Process

GO:0051301 cell division Biological Process

GO:0061025 membrane fusion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT1G08560

ath:AT1G11250

ath:AT1G61290

ath:AT4G03330

osa:107276918

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.641

Rank 1 · LXL04_022947 · OH-1004

Cytoplasm0.253

Rank 2 · LXL04_022947 · OH-1004

Lysosome / Vacuole0.124

Rank 3 · LXL04_022947 · OH-1004

Golgi apparatus0.106

Rank 4 · LXL04_022947 · OH-1004

Endoplasmic reticulum0.096

Rank 5 · LXL04_022947 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00804.32Syntaxin42-195 aa

PF05739.27SNARE221-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022947	`PF00804.32`	Syntaxin	42	195	7.5e-51	172.8
LXL04_022947	`PF05739.27`	SNARE	221	297	2.6e-25	88.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42374`	Arabidopsis thaliana	Syntaxin-related protein KNOLLE	68.339%	Swiss-Prot	strong database homology
`O64791`	Arabidopsis thaliana	Syntaxin-124	49.518%	Swiss-Prot	moderate database homology
`Q9SXB0`	Arabidopsis thaliana	Syntaxin-125	49.153%	Swiss-Prot	moderate database homology
`Q9ZQZ8`	Arabidopsis thaliana	Syntaxin-123	47.588%	Swiss-Prot	moderate database homology
`Q84R43`	Oryza sativa subsp. japonica	Syntaxin-111	59.434%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card