LXL04_022931 | RubberDandelionOmics

Gene overview

LXL04_022931

Reference: OH-1004 Chr: Chr05 Coordinates: 14057348-14058670 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · LXL04_022931|LXL04_022931|OH1004|cDNA

ATGAAACATAACTTCACCTCCAATCCCCCAATGGATTCGGCTAGGCACACATGCTTGAAACTCCAAATCGCCCAAGATCGTCACCCATTTTTCATCAAAGGCACCTGGTTTCCTTCTCACTTCGATCTCTCAATCACCGACGGCCAAAACGCTTGGACTTGCAACGCGTCAGAAGAAGACGTGAAGGAGAGAGCGTCTAATTGGGACCAACCGACATCTGAGTACATCGATTTATCGGAGCGCTATTTAGGGTTTCAACA...

CDS

Download CDS FASTA

801 bp · LXL04_022931|LXL04_022931|OH1004|CDS

ATGAAACATAACTTCACCTCCAATCCCCCAATGGATTCGGCTAGGCACACATGCTTGAAACTCCAAATCGCCCAAGATCGTCACCCATTTTTCATCAAAGGCACCTGGTTTCCTTCTCACTTCGATCTCTCAATCACCGACGGCCAAAACGCTTGGACTTGCAACGCGTCAGAAGAAGACGTGAAGGAGAGAGCGTCTAATTGGGACCAACCGACATCTGAGTACATCGATTTATCGGAGCGCTATTTAGGGTTTCAACA...

Protein

Download Protein FASTA

266 aa · LXL04_022931|LXL04_022931|OH1004|PROTEIN

MKHNFTSNPPMDSARHTCLKLQIAQDRHPFFIKGTWFPSHFDLSITDGQNAWTCNASEEDVKERASNWDQPTSEYIDLSERYLGFQQPGSVYGFTDAGGGNKRLSWTFKKEGTKLEWRWKFNPAEDSKKITASILDFLMDSNIRLSEEVVMKTRSNEKLKTEAEKCLAQSEKFQNEKAEFETTIYSKFLGVLNSKKAKLRELRDKMSNQEIGVKPEEEEDEGESTDRTETYEGDSEDADVEENTATNVTSTSKGALENKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022931`
TK1151 ID	TkA06G426780
OH-1004 ID	LXL04_022931
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 96.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022931

Location Chr05:14057348-14058670 (-)

Description Similar to XRCC4: DNA repair protein XRCC4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23100`	May be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022931 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006284 base-excision repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0010165 response to X-ray Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0048146 positive regulation of fibroblast proliferation Biological Process

GO:0051351 positive regulation of ligase activity Biological Process

GO:0061819 telomeric DNA-containing double minutes formation Biological Process

GO:1905765 negative regulation of protection from non-homologous end joining at telomere Biological Process

GO:1990166 protein localization to site of double-strand break Biological Process

KEGG gene cross-reference

ath:AT3G23100

hsa:7518

mmu:108138

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.886

Rank 1 · LXL04_022931 · OH-1004

Cytoplasm0.218

Rank 2 · LXL04_022931 · OH-1004

Mitochondrion0.031

Rank 3 · LXL04_022931 · OH-1004

Cell membrane0.026

Rank 4 · LXL04_022931 · OH-1004

Golgi apparatus0.013

Rank 5 · LXL04_022931 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09302.17XLF21-121 aa

PF06632.18XRCC429-121 aa

PF21924.2XRCC4_CC151-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022931	`PF09302.17`	XLF	21	121	4.9e-06	27.6
LXL04_022931	`PF06632.18`	XRCC4	29	121	8.4e-29	100.2
LXL04_022931	`PF21924.2`	XRCC4_CC	151	202	5.6e-09	36.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q682V0`	Arabidopsis thaliana	DNA repair protein XRCC4	60.714%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card