LXL04_022902 | RubberDandelionOmics

Gene overview

LXL04_022902

Reference: OH-1004 Chr: Chr05 Coordinates: 13038029-13038958 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · LXL04_022902|LXL04_022902|OH1004|cDNA

ATGAAAACAACCCTTTCATACCTCCTGTTCACCGGACTATTTCTTGCCGGAATCCTCCTCCTCCCGGAGCAAGTTACATCACAAAACTGTAACTGTGCCTCGCGAGAGTGTTGTAGCAAGTTCGGTTACTGTGGCACCACCCAAGACTATTGCGGGAAAGACTGTCGAAGTGGCCCATGTTCTCTGCCAGCTCCTAATAACAATGCCGACGTCCCTGGTATAGTGACCAACGCTTTTTTTAACGGGATTGTTTCAAAGTC...

CDS

Download CDS FASTA

828 bp · LXL04_022902|LXL04_022902|OH1004|CDS

ATGAAAACAACCCTTTCATACCTCCTGTTCACCGGACTATTTCTTGCCGGAATCCTCCTCCTCCCGGAGCAAGTTACATCACAAAACTGTAACTGTGCCTCGCGAGAGTGTTGTAGCAAGTTCGGTTACTGTGGCACCACCCAAGACTATTGCGGGAAAGACTGTCGAAGTGGCCCATGTTCTCTGCCAGCTCCTAATAACAATGCCGACGTCCCTGGTATAGTGACCAACGCTTTTTTTAACGGGATTGTTTCAAAGTC...

Protein

Download Protein FASTA

275 aa · LXL04_022902|LXL04_022902|OH1004|PROTEIN

MKTTLSYLLFTGLFLAGILLLPEQVTSQNCNCASRECCSKFGYCGTTQDYCGKDCRSGPCSLPAPNNNADVPGIVTNAFFNGIVSKSASNCPGRRFYTRDVFLRVIKDFPHFGRSGSIDDSKREIAAFFAHVTHETGHFCYIEETGGRSKDYCDETKQSEYPCAPNKGYYGRGPIQLSYNYNYGEAGKNLKLDLLRNPEIVATDQVVSFKTAVWFWMEHAHWDFASGNGFGASIRAVNKIECDGGNGGAVSSRVNFYNEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022902`
TK1151 ID	TkA06G430320
OH-1004 ID	LXL04_022902
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022902

Location Chr05:13038029-13038958 (+)

Description Similar to EP3: Endochitinase EP3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54420`	Probably involved in hypersensitive reaction upon Xanthomonas campestris infection.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0605900`	May function in reproductive organs during embryogenesis and seed maturation.	No verified direct reference in this release
`Os04g0494100`	May function in reproductive organs during embryogenesis and seed maturation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022902 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0016998 cell wall macromolecule catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004568 chitinase activity Molecular Function

GO:0008061 chitin binding Molecular Function

KEGG gene cross-reference

ath:AT3G54420

bna:106388328

dosa:Os02g0605900

dosa:Os04g0494100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.518

Rank 1 · LXL04_022902 · OH-1004

Lysosome / Vacuole0.271

Rank 2 · LXL04_022902 · OH-1004

Cell membrane0.112

Rank 3 · LXL04_022902 · OH-1004

Cytoplasm0.110

Rank 4 · LXL04_022902 · OH-1004

Endoplasmic reticulum0.084

Rank 5 · LXL04_022902 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00187.25Chitin_bind_128-60 aa

PF00182.25Glyco_hydro_1974-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022902	`PF00187.25`	Chitin_bind_1	28	60	1.3e-07	32.4
LXL04_022902	`PF00182.25`	Glyco_hydro_19	74	219	6.9e-45	154.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U5`	Arabidopsis thaliana	Endochitinase EP3	55.435%	Swiss-Prot	strong database homology
`Q6K8R2`	Oryza sativa subsp. japonica	Chitinase 6	54.618%	Swiss-Prot	strong database homology
`Q7Y1Z0`	Oryza sativa subsp. japonica	Chitinase 5	53.184%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card