LXL04_022768 | RubberDandelionOmics

Gene overview

LXL04_022768

Reference: OH-1004 Chr: Chr05 Coordinates: 8564575-8573647 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1854 bp · LXL04_022768|LXL04_022768|OH1004|cDNA

ATGCAGGCCAAAGCATATAATTTCATCCCACCGAAACCATCGTCCCCATCAATCAAACTGCCGCCACCCAACGTGATCTCATTTCCCGGCGATCATGTTCCTCAAGAAATCTCCATAGCTATACCAAGTCAACAAGTAACATCTAAAACTTCAACTTCTATTCAAGAAAAAAAACTAGCAGCTTACTGGGATTACCAGTCTTTGTTCGTCTCACAACGAACAGAAACTGCTAATCCCGTTAGTCTGCGAGTCGTAGAAGG...

CDS

Download CDS FASTA

1854 bp · LXL04_022768|LXL04_022768|OH1004|CDS

ATGCAGGCCAAAGCATATAATTTCATCCCACCGAAACCATCGTCCCCATCAATCAAACTGCCGCCACCCAACGTGATCTCATTTCCCGGCGATCATGTTCCTCAAGAAATCTCCATAGCTATACCAAGTCAACAAGTAACATCTAAAACTTCAACTTCTATTCAAGAAAAAAAACTAGCAGCTTACTGGGATTACCAGTCTTTGTTCGTCTCACAACGAACAGAAACTGCTAATCCCGTTAGTCTGCGAGTCGTAGAAGG...

Protein

Download Protein FASTA

617 aa · LXL04_022768|LXL04_022768|OH1004|PROTEIN

MQAKAYNFIPPKPSSPSIKLPPPNVISFPGDHVPQEISIAIPSQQVTSKTSTSIQEKKLAAYWDYQSLFVSQRTETANPVSLRVVEGSIPSDFPLGTYYLTGPGLFKDDFGSTVHPLDGHGYLRAFTIDGAKGEITYMARYIKTAAQVEEHDGETGEWRFTHRGPFSVLKNGKKIGNTKVMKNVANTSVLRWGDRLFCLWEGGAPYEIESASLDTVGKFDLINNSNGSILDEHMVDHRWDVLDLAAGILKPILYGIFNMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022768`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022768

Location Chr05:8564575-8573647 (-)

Description Similar to CCD7: Carotenoid cleavage dioxygenase 7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44990`	Involved in strigolactones biosynthesis by cleaving asymmetrically a variety of linear and cyclic carotenoids at the 9-10 double bond.	MAX3/CCD7 is a carotenoid cleavage dioxygenase required for the synthesis of a novel plant signaling molecule.2004 · DOI: 10.1016/j.cub.2004.06.061 Characterization of three members of the Arabidopsis carotenoid cleavage dioxygenase family demonstrates the divergent roles of this multifunctional enzyme family.2006 · DOI: 10.1111/j.1365-313x.2006.02666.x
`At3g24220`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	Functional analysis of Arabidopsis NCED6 and NCED9 genes indicates that ABA synthesized in the endosperm is involved in the induction of seed dormancy.2006 · DOI: 10.1111/j.1365-313x.2005.02622.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0550600`	Involved in strigolactones biosynthesis by cleaving asymmetrically a variety of linear and cyclic carotenoids at the 9-10 double bond.	The rice HIGH-TILLERING DWARF1 encoding an ortholog of Arabidopsis MAX3 is required for negative regulation of the outgrowth of axillary buds.2006 · DOI: 10.1111/j.1365-313x.2006.02916.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022768 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009635 response to herbicide Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010114 response to red light Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0016121 carotene catabolic process Biological Process

GO:0016124 xanthophyll catabolic process Biological Process

GO:1901601 strigolactone biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ag:ACP17973

ath:AT2G44990

ath:AT3G24220

dosa:Os04g0550600

syn:sll1541

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · LXL04_022768 · OH-1004

Mitochondrion0.035

Rank 2 · LXL04_022768 · OH-1004

Cytoplasm0.027

Rank 3 · LXL04_022768 · OH-1004

Peroxisome0.023

Rank 4 · LXL04_022768 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_022768 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055.22RPE6570-612 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022768	`PF03055.22`	RPE65	70	612	1.7e-94	318.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJM2`	Arabidopsis thaliana	Carotenoid cleavage dioxygenase 7, chloroplastic	60.000%	Swiss-Prot	strong database homology
`Q9LRM7`	Arabidopsis thaliana	9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic	22.342%	Swiss-Prot	weak database homology
`Q7XU29`	Oryza sativa subsp. japonica	Carotenoid cleavage dioxygenase 7, chloroplastic	58.571%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card