LXL04_022761 | RubberDandelionOmics

Gene overview

LXL04_022761

Reference: OH-1004 Chr: Chr05 Coordinates: 8363094-8364152 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_022761|LXL04_022761|OH1004|cDNA

ATGCTCCGCTCATTATTTGTTCTGGTACTCTTCTATCCCACATATTTCCTGGCCAGACCAACGCCTCCGGCAACCACCACTTTCTCCACCATCAACCGCCGGAACCCCACCTGGGGAAACTTTGGGAAGCTCCTTAATACCACAAAGGGTAGCAACTTCAGCGGCATATCGGAGCTCAAGAAATACATGCAACGTTTTGGATACCTCAAGGTCACCAACTTAAGCTCCGGCGACAACTTTGATTACCAATTGGAGATCGC...

CDS

Download CDS FASTA

1059 bp · LXL04_022761|LXL04_022761|OH1004|CDS

ATGCTCCGCTCATTATTTGTTCTGGTACTCTTCTATCCCACATATTTCCTGGCCAGACCAACGCCTCCGGCAACCACCACTTTCTCCACCATCAACCGCCGGAACCCCACCTGGGGAAACTTTGGGAAGCTCCTTAATACCACAAAGGGTAGCAACTTCAGCGGCATATCGGAGCTCAAGAAATACATGCAACGTTTTGGATACCTCAAGGTCACCAACTTAAGCTCCGGCGACAACTTTGATTACCAATTGGAGATCGC...

Protein

Download Protein FASTA

352 aa · LXL04_022761|LXL04_022761|OH1004|PROTEIN

MLRSLFVLVLFYPTYFLARPTPPATTTFSTINRRNPTWGNFGKLLNTTKGSNFSGISELKKYMQRFGYLKVTNLSSGDNFDYQLEIAVTQYQQKLGLALTGKLDSGTISQMTVPRCGVPDTSPPSKFHAIRHYNYFNGKPRWSRAIPTTLTYAFSANCMVSNLNISDIKLAFRRSFTRWSAVIPVNFTESEYYEFSDIKIGFYAGDHDDGEPFDGVLGVLAHGFSPESGKLHLDAAETWAMDFKSEKSKVAIDLESVATH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022761`
TK1151 ID	TkA06G451090
OH-1004 ID	LXL04_022761
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 82.386 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022761

Location Chr05:8363094-8364152 (-)

Description Similar to 1MMP: Metalloendoproteinase 1-MMP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16640`	Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses.	No verified direct reference in this release
`At2g45040`	Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity).	No verified direct reference in this release
`At1g70170`	Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity).	No verified direct reference in this release
`At1g24140`	Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity).	No verified direct reference in this release
`At1g59970`	Matrix metalloproteinases (MMPs) or matrixins may play a role in the degradation and remodeling of the extracellular matrix (ECM) during development or in response to stresses (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022761 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0030198 extracellular matrix organization Biological Process

GO:0030574 collagen catabolic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24140

ath:AT1G59970

ath:AT1G70170

ath:AT2G45040

ath:AT4G16640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.263

Rank 1 · LXL04_022761 · OH-1004

Cell membrane0.252

Rank 2 · LXL04_022761 · OH-1004

Endoplasmic reticulum0.114

Rank 3 · LXL04_022761 · OH-1004

Lysosome / Vacuole0.084

Rank 4 · LXL04_022761 · OH-1004

Cytoplasm0.070

Rank 5 · LXL04_022761 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01471.24PG_binding_155-111 aa

PF00413.31Peptidase_M10145-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022761	`PF01471.24`	PG_binding_1	55	111	3e-09	37.7
LXL04_022761	`PF00413.31`	Peptidase_M10	145	304	6.7e-49	166.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23507`	Arabidopsis thaliana	Metalloendoproteinase 1-MMP	49.718%	Swiss-Prot	moderate database homology
`Q8GWW6`	Arabidopsis thaliana	Metalloendoproteinase 4-MMP	54.196%	Swiss-Prot	strong database homology
`O04529`	Arabidopsis thaliana	Metalloendoproteinase 2-MMP	43.127%	Swiss-Prot	moderate database homology
`Q5XF51`	Arabidopsis thaliana	Metalloendoproteinase 3-MMP	41.867%	Swiss-Prot	moderate database homology
`Q9ZUJ5`	Arabidopsis thaliana	Metalloendoproteinase 5-MMP	38.719%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card