LXL04_022654 | RubberDandelionOmics

Gene overview

LXL04_022654

Reference: OH-1004 Chr: Chr05 Coordinates: 4135662-4138234 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2094 bp · LXL04_022654|LXL04_022654|OH1004|cDNA

ATGGCTCCTAACAAAGATAATGAAGACACTATAACTTGGGACAATGATAATATTGTAAAGTTTTGTGAGGTTTGTATCAACTACATTACTAAGAATGGACGTGGTCAACAAATGAGATGGCGAGAaatagaagatttgtttgcGGAAAGGGTTGGTTGGAATGCAACGACGGGGATGTTAGATTGTTCGAACGAATGGTGGGAAAGAAAGCTCAAGGAGAAACCGGAGGCCAAGAAGTACAGACACAAGGGAGTCTTTCC...

CDS

Download CDS FASTA

2094 bp · LXL04_022654|LXL04_022654|OH1004|CDS

ATGGCTCCTAACAAAGATAATGAAGACACTATAACTTGGGACAATGATAATATTGTAAAGTTTTGTGAGGTTTGTATCAACTACATTACTAAGAATGGACGTGGTCAACAAATGAGATGGCGAGAAATAGAAGATTTGTTTGCGGAAAGGGTTGGTTGGAATGCAACGACGGGGATGTTAGATTGTTCGAACGAATGGTGGGAAAGAAAGCTCAAGGAGAAACCGGAGGCCAAGAAGTACAGACACAAGGGAGTCTTTCC...

Protein

Download Protein FASTA

697 aa · LXL04_022654|LXL04_022654|OH1004|PROTEIN

MAPNKDNEDTITWDNDNIVKFCEVCINYITKNGRGQQMRWREIEDLFAERVGWNATTGMLDCSNEWWERKLKEKPEAKKYRHKGVFPSVEEKWDQLFGDAVATGVGCVAPSLNPECVDKVTNVEDQIQDVDGWSKEAYHEYSQYATLESLDYQEGTFWQNFTQEVSGNPNPTDIAMPKTNKSVKRRKRESGGSALMREHIHGSQERHSEIVGLINQGRNNKKDDAGISIAQAMDIINRMTANSKVEIGGDIWWRAMQLFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022654`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_022654`
Location	Chr05:4135662-4138234 (-)
Description	Similar to Harbi1: Putative nuclease HARBI1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022654` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0034451 centriolar satellite Cellular Component GO:0004518 nuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	bta:514442 hsa:283254 mmu:241547 rno:690164 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · LXL04_022654 · OH-1004

Cytoplasm0.171

Rank 2 · LXL04_022654 · OH-1004

Mitochondrion0.020

Rank 3 · LXL04_022654 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_022654 · OH-1004

Extracellular0.010

Rank 5 · LXL04_022654 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26138.1DUF8040333-428 aa

PF04827.21Plant_tran470-639 aa

PF01609.28DDE_Tnp_1472-630 aa

PF13359.13DDE_Tnp_4473-634 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022654	`PF26138.1`	DUF8040	333	428	1.5e-36	124.8
LXL04_022654	`PF04827.21`	Plant_tran	470	639	2e-08	34.8
LXL04_022654	`PF01609.28`	DDE_Tnp_1	472	630	1.1e-11	45.6
LXL04_022654	`PF13359.13`	DDE_Tnp_4	473	634	2.1e-23	83.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card