LXL04_022617 | RubberDandelionOmics

Gene overview

LXL04_022617

Reference: OH-1004 Chr: Chr05 Coordinates: 2583703-2587506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1065 bp · LXL04_022617|LXL04_022617|OH1004|cDNA

ATGGCTTGTCTAGGCATGACGGTGGTGTCAATGGCGAAACCCTCGTTTCTACGAGCCGAGCAACCTTCAGTTCCTGATCACTCCGCCGCAACCTCTCCTGGATCATCTTCCTCCCGCCGCCGCGACCTTGTGTTCATCGTCAATCCTCAAGGTGCTAATGGTCGGACCGGGAGAGAATGGAAGAAGCTGCTGCCATATCTTAGGTCTCGCCTAGGTAGCGATTGTAATATATGCGAATCTTTGACTTCAGGTCCATCTCA...

CDS

Download CDS FASTA

1065 bp · LXL04_022617|LXL04_022617|OH1004|CDS

ATGGCTTGTCTAGGCATGACGGTGGTGTCAATGGCGAAACCCTCGTTTCTACGAGCCGAGCAACCTTCAGTTCCTGATCACTCCGCCGCAACCTCTCCTGGATCATCTTCCTCCCGCCGCCGCGACCTTGTGTTCATCGTCAATCCTCAAGGTGCTAATGGTCGGACCGGGAGAGAATGGAAGAAGCTGCTGCCATATCTTAGGTCTCGCCTAGGTAGCGATTGTAATATATGCGAATCTTTGACTTCAGGTCCATCTCA...

Protein

Download Protein FASTA

354 aa · LXL04_022617|LXL04_022617|OH1004|PROTEIN

MACLGMTVVSMAKPSFLRAEQPSVPDHSAATSPGSSSSRRRDLVFIVNPQGANGRTGREWKKLLPYLRSRLGSDCNICESLTSGPSHAIDITREAIREGADAVVAVGGDGTLHEVVNGFFWGGKPVTKHDSKVPRTTSLGLIPLGTGSDFARTFGWTNDPVDAIERLVKGRSKSRIDVGVITKEGGDLHYFINVADIHLSAKAGYHASKYKRFGSLCYVIGALQAFFGHHNQDLKIKVNDGEWEVYPKVTALCIGNAKFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022617`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022617

Location Chr05:2583703-2587506 (+)

Description Similar to LCKB2: Sphingoid long-chain bases kinase 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46090`	Involved in the production of sphingoid long-chain base (LCB).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022617 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006665 sphingolipid metabolic process Biological Process

GO:0006671 phytosphingosine metabolic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009247 glycolipid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004143 ATP-dependent diacylglycerol kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008481 sphingosine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G46090

mtu:Rv2252

mtv:RVBD_2252

sca:SCA_1470

ssp:SSP0893

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.277

Rank 1 · LXL04_022617 · OH-1004

Cytoplasm0.190

Rank 2 · LXL04_022617 · OH-1004

Mitochondrion0.167

Rank 3 · LXL04_022617 · OH-1004

Endoplasmic reticulum0.146

Rank 4 · LXL04_022617 · OH-1004

Cell membrane0.145

Rank 5 · LXL04_022617 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00781.30DAGK_cat43-179 aa

PF19279.5YegS_C201-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022617	`PF00781.30`	DAGK_cat	43	179	1.1e-26	93.6
LXL04_022617	`PF19279.5`	YegS_C	201	353	1.7e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82359`	Arabidopsis thaliana	Sphingoid long-chain bases kinase 2, mitochondrial	69.916%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card