LXL04_022576 | RubberDandelionOmics

Gene overview

LXL04_022576

Reference: OH-1004 Chr: Chr05 Coordinates: 1741797-1747493 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2124 bp · LXL04_022576|LXL04_022576|OH1004|cDNA

atggGCATGAAGAAATATGTTGTAGAGATTGAAAAGGCAAAACAAGCCCAAGGTGGCAGCCCGTCAGTTGGTCCTGTTTACCGGAATGTGCTGGCAAAAGATGGATTCCGGCCACTTGCTCATGGTGTCAATAGTTGTTGGGATGTTTTCCGTTTATCAGTGGAGAAACATCCTAACAACCAGATGCTTGGCGAGAGGGAGATTATTGATGGCAAGGCTGGTAAATATGTTTGGTTAACTTACAAGGAAGTATATGATAC...

CDS

Download CDS FASTA

2124 bp · LXL04_022576|LXL04_022576|OH1004|CDS

ATGGGCATGAAGAAATATGTTGTAGAGATTGAAAAGGCAAAACAAGCCCAAGGTGGCAGCCCGTCAGTTGGTCCTGTTTACCGGAATGTGCTGGCAAAAGATGGATTCCGGCCACTTGCTCATGGTGTCAATAGTTGTTGGGATGTTTTCCGTTTATCAGTGGAGAAACATCCTAACAACCAGATGCTTGGCGAGAGGGAGATTATTGATGGCAAGGCTGGTAAATATGTTTGGTTAACTTACAAGGAAGTATATGATAC...

Protein

Download Protein FASTA

707 aa · LXL04_022576|LXL04_022576|OH1004|PROTEIN

MGMKKYVVEIEKAKQAQGGSPSVGPVYRNVLAKDGFRPLAHGVNSCWDVFRLSVEKHPNNQMLGEREIIDGKAGKYVWLTYKEVYDTVLNVGQSIYNCGIKKGARCGIYGINCTKWVVSMQACNALGLHCVPLYDTLGAGAVKYIICHAEVSIIFAEATKISEVLKTFPDTSKYLKTLVSFTTITNEHKSVAEKYGLEIYSWEEFLHLSKESKDGVDLPMKMTSDICTIMYTSGTTGEPKGVMITNESILSMLSGVTHHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022576`
TK1151 ID	TkA06G475400
OH-1004 ID	LXL04_022576
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 99.090 / OH-1004 92.645 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022576

Location Chr05:1741797-1747493 (+)

Description Similar to LACS4: Long chain acyl-CoA synthetase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23850`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release
`At4g11030`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release
`At1g64400`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release
`At1g49430`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	The acyl-CoA synthetase encoded by LACS2 is essential for normal cuticle development in Arabidopsis.2004 · DOI: 10.1105/tpc.017608 A permeable cuticle in Arabidopsis leads to a strong resistance to Botrytis cinerea.2007 · DOI: 10.1038/sj.emboj.7601658 Mutations in LACS2, a long-chain acyl-coenzyme A synthetase, enhance susceptibility to avirulent Pseudomonas syringae but confer resistance to Botrytis cinerea in Arabidopsis.2007 · DOI: 10.1104/pp.106.094318

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022576 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010311 lateral root formation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080024 indolebutyric acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G49430

ath:AT1G64400

ath:AT4G11030

ath:AT4G23850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.317

Rank 1 · LXL04_022576 · OH-1004

Endoplasmic reticulum0.287

Rank 2 · LXL04_022576 · OH-1004

Peroxisome0.174

Rank 3 · LXL04_022576 · OH-1004

Mitochondrion0.127

Rank 4 · LXL04_022576 · OH-1004

Nucleus0.094

Rank 5 · LXL04_022576 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding64-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022576	`PF00501.35`	AMP-binding	64	486	5.2e-80	269.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T0A0`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 4	66.462%	Swiss-Prot	strong database homology
`Q9T009`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 5	65.237%	Swiss-Prot	strong database homology
`Q9C7W4`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 3	65.658%	Swiss-Prot	strong database homology
`Q9XIA9`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 2	52.504%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card