LXL04_022449 | RubberDandelionOmics

Gene overview

LXL04_022449

Reference: OH-1004 Chr: Chr04 Coordinates: 150541965-150542373 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

311 bp · LXL04_022449|LXL04_022449|OH1004|cDNA

CTGTTTCCGATCTACATAATCACcatcatctctctctctctctctctctctctcacttaCTCACTCACATTTTCCGGCAGTGTGTGAAGATGAGGCCTTCCATGAAGCTGATTGTAACACTGTTGCTTGCACTCTTGTGTCTCATGGCCACTGAAACGGTGGAAGGGAGGACGTGCGAGTCGCAGAGCCACAAGTTCAAGGGGACGTGCGTCAGCAACACCAACTGCGGCAATGTGTGCAAGAATGAGGGCTTTTATGCC...

CDS

Download CDS FASTA

222 bp · LXL04_022449|LXL04_022449|OH1004|CDS

ATGAGGCCTTCCATGAAGCTGATTGTAACACTGTTGCTTGCACTCTTGTGTCTCATGGCCACTGAAACGGTGGAAGGGAGGACGTGCGAGTCGCAGAGCCACAAGTTCAAGGGGACGTGCGTCAGCAACACCAACTGCGGCAATGTGTGCAAGAATGAGGGCTTTTATGCCGGAAAGTGCCGTGGGTTCCGACGACGTTGCTACTGCACTAAACACTGTTAA

Protein

Download Protein FASTA

73 aa · LXL04_022449|LXL04_022449|OH1004|PROTEIN

MRPSMKLIVTLLLALLCLMATETVEGRTCESQSHKFKGTCVSNTNCGNVCKNEGFYAGKCRGFRRRCYCTKHC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022449`
TK1151 ID	TkA05G469190
OH-1004 ID	LXL04_022449
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 70.192 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022449

Location Chr04:150541965-150542373 (-)

Description Similar to SD2: Defensin SD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02100`	Confers broad-spectrum resistance to pathogens.	No verified direct reference in this release
`At2g02130`	Confers broad-spectrum resistance to pathogens.	No verified direct reference in this release
`At2g02120`	Confers broad-spectrum resistance to pathogens.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022449 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G02100

ath:AT2G02120

ath:AT2G02130

cann:107838795

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.915

Rank 1 · LXL04_022449 · OH-1004

Cytoplasm0.045

Rank 2 · LXL04_022449 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_022449 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_022449 · OH-1004

Golgi apparatus0.019

Rank 5 · LXL04_022449 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00304.27Gamma-thionin27-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022449	`PF00304.27`	Gamma-thionin	27	73	2.9e-18	66.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39182`	Arabidopsis thaliana	Defensin-like protein 2	62.338%	Swiss-Prot	strong database homology
`Q9ZUL7`	Arabidopsis thaliana	Defensin-like protein 1	61.039%	Swiss-Prot	strong database homology
`Q41914`	Arabidopsis thaliana	Defensin-like protein 4	58.442%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card