LXL04_022400 | RubberDandelionOmics

Gene overview

LXL04_022400

Reference: OH-1004 Chr: Chr04 Coordinates: 149542010-149545691 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3186 bp · LXL04_022400|LXL04_022400|OH1004|cDNA

ATGGCTCTTACACCGAACGATACAATTTCACCGGGAATGAAGGTTTTAGCAATGGAGAGAACTCCCGCAGCTTGTGCCATGGATTGGAGCATTCATCTCGACAAAGCCCTACGCTCCAATAACCCTGGAAAACGCAAGGAAGCCATACAAGAGGTTGGGGCTAGGCTGGAGCGATGGAGCAAGGAGCCCGAGCTTTCTATGGCTGAACATAACATGTTTGGCTTAGTCCCCGGAGAGGATAAGCTATTTTCAAATGCCAT...

CDS

Download CDS FASTA

3186 bp · LXL04_022400|LXL04_022400|OH1004|CDS

ATGGCTCTTACACCGAACGATACAATTTCACCGGGAATGAAGGTTTTAGCAATGGAGAGAACTCCCGCAGCTTGTGCCATGGATTGGAGCATTCATCTCGACAAAGCCCTACGCTCCAATAACCCTGGAAAACGCAAGGAAGCCATACAAGAGGTTGGGGCTAGGCTGGAGCGATGGAGCAAGGAGCCCGAGCTTTCTATGGCTGAACATAACATGTTTGGCTTAGTCCCCGGAGAGGATAAGCTATTTTCAAATGCCAT...

Protein

Download Protein FASTA

1061 aa · LXL04_022400|LXL04_022400|OH1004|PROTEIN

MALTPNDTISPGMKVLAMERTPAACAMDWSIHLDKALRSNNPGKRKEAIQEVGARLERWSKEPELSMAEHNMFGLVPGEDKLFSNAILLRLADSFMSGDKHTKLSIVKVFMSELKHRKTKGSNRKNKGILLKNKVENHLELLRRVKVCFNSGDEDVRALALALFGCWSDFAKDNADIRYLILSSLVSCHVLEVKASLFAAGCFCEFSDDFAHVLLEMLSNMVLSPDIPIAGRVAGVRAFAKLGRSSTLSTKAYEEGLKLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022400`
TK1151 ID	TkA05G464840
OH-1004 ID	LXL04_022400
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 11.499 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_022400`
Location	Chr04:149542010-149545691 (+)
Description	Similar to INTS7: Integrator complex subunit 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022400` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006974 DNA damage response Biological Process GO:0016180 snRNA processing Biological Process GO:0034243 regulation of transcription elongation by RNA polymerase II Biological Process GO:0034472 snRNA 3'-end processing Biological Process GO:0071479 cellular response to ionizing radiation Biological Process GO:0160240 RNA polymerase II transcription initiation surveillance Biological Process GO:0005634 nucleus Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016604 nuclear body Cellular Component GO:0032039 integrator complex Cellular Component
KEGG gene cross-reference	bta:534964 ddi:DDB_G0284483 dre:286776 gga:421374 mmu:77065 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.585

Rank 1 · LXL04_022400 · OH-1004

Cytoplasm0.273

Rank 2 · LXL04_022400 · OH-1004

Cell membrane0.090

Rank 3 · LXL04_022400 · OH-1004

Endoplasmic reticulum0.083

Rank 4 · LXL04_022400 · OH-1004

Golgi apparatus0.079

Rank 5 · LXL04_022400 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24436.3INTS7_N83-603 aa

PF24437.3INTS7_HB609-727 aa

PF22966.2INTS7_C_plants903-1058 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022400	`PF24436.3`	INTS7_N	83	603	2.6e-43	149.6
LXL04_022400	`PF24437.3`	INTS7_HB	609	727	8.8e-07	29.9
LXL04_022400	`PF22966.2`	INTS7_C_plants	903	1058	4.5e-48	163.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card